Meghirdetés - Idő szerint sorbarendezett lista

Utolsó módosítás: 2014-11-21 02:35:01

SorszámDomain neveIgénylőBejegyzett feltételes használat kezdeteRészletek
1opuseteducatio.huHorváth Cz. János2014-11-20 19:01:22részletek
2hirlevel-kikuldes.huBoardland.hu Kft. 2014-11-20 19:01:22részletek
3regisztracios-ado.huKovács Péter2014-11-20 19:01:22részletek
4regkft.huReal Estate & Garden Solutions Kft.2014-11-20 19:01:22részletek
5icrypt.huINTEGRITY Kft.2014-11-20 19:01:22részletek
6clickbox.huSwift Technologies Kft.2014-11-20 19:01:22részletek
7szip-map.hueNET Internetkutató és Tanácsadó Kft.2014-11-20 19:01:22részletek
8gergelysanyi.huGergely Sándor2014-11-20 19:01:21részletek
9onlinepizzeria.huGergely László Andras2014-11-20 19:01:21részletek
10eriknewmanmusic.huExtrico Systems Hungary Zrt.2014-11-20 19:01:21részletek
11csaladikonfliktusok.huAranyos Zsolt2014-11-20 19:01:21részletek
12anovenydoki.huUjvári Péter2014-11-20 19:01:21részletek
13probiotikum-blog.huVitaminKosár Kft.2014-11-20 19:01:21részletek
14bcfxbroker.huRozgonyi György2014-11-20 19:01:21részletek
15okosinstallácio.huLeme Kft2014-11-20 19:01:21részletek
16dalakedvesnek.huALTAweb Kft.2014-11-20 19:01:20részletek
17fabutorpecs.huPernyéz Viktor2014-11-20 19:01:20részletek
18zoldso.huB és K Trade Kft.2014-11-20 19:01:20részletek
19keklagunahaz.huBest-Impex Kft2014-11-20 19:01:20részletek
20iyassu.huBerenyi Rita2014-11-20 19:01:20részletek
21blogprobiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
22blog-probiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
23netniko.huNetniko Kft.2014-11-20 19:01:20részletek
24military-vadasz.huBojtor Tamás2014-11-20 19:01:19részletek
25pureleverage.huWebsupport s.r.o.2014-11-20 19:01:19részletek
26lehneruveg.huLéhner Szilveszter2014-11-20 19:01:19részletek
27topacel.huTop Acél Kft.2014-11-20 19:01:19részletek
28365suti.huWe are design Kft.2014-11-20 19:01:19részletek
29danubewedding.huVarga-Kovács Tímea2014-11-20 19:01:19részletek
30homepilates.huKocsis Katalin2014-11-20 19:01:19részletek
31sextopbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:18részletek
32nagycsaladosok-kondoros.huMegaweb kft2014-11-20 19:01:18részletek
33youngbeauty.huYoung Beauty Bt.2014-11-20 19:01:18részletek
34jujitsunyh.huBélteczki Csaba2014-11-20 19:01:18részletek
35elvisz-busz.huK. és Z. Bt.2014-11-20 19:01:18részletek
36lkwstore.huZsámbok János2014-11-20 19:01:18részletek
37lashandnail.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:18részletek
38rehatechnika.huReha-Technika Kft.2014-11-20 19:01:18részletek
39mafoakadémia.huMagyarországi Foglalkoztatási és Oktatási Kft.2014-11-20 19:01:17részletek
40sorozatvago.huIwood Kft.2014-11-20 19:01:17részletek
41bminfo.hueCapital.hu Kft.2014-11-20 19:01:17részletek
42entone.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
43mag250.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
44ottbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
45tvjegy.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
46probiotikumblog.huVitaminKosár Kft.2014-11-20 19:01:17részletek
47nemzetiminibusz.huAM Logistic Kft. 2014-11-20 19:01:16részletek
48nemzetiminibus.huAM Logistic Kft. 2014-11-20 19:01:16részletek
49foodintertrade.huFood Intertrade Kft.2014-11-20 19:01:16részletek
50javaszoftverfejlesztes.huSinkovits Balázs2014-11-20 19:01:16részletek
51roku.huEuroCable Magyarorszag Kft.2014-11-20 19:01:16részletek
52szamocahaz.huSzabó Mónika2014-11-20 19:01:16részletek
53pontapps.huPont Systems Zrt.2014-11-20 19:01:16részletek
54masszazsterapiapecs.huHatházi Milán Attila2014-11-20 19:01:16részletek
55bodzsi.huHorváthné Bodzsár Szilvia 2014-11-20 19:01:15részletek
56kalauzhal.huJónap Richárd2014-11-20 19:01:15részletek
57epitesiminoseg.huBertoja-Berend András2014-11-20 19:01:15részletek
58minosegiepites.huBertoja-Berend András2014-11-20 19:01:15részletek
59ngmmotor.huNGM Motorfelújító Kft.2014-11-20 19:01:15részletek
60luxus-szonyeg.huVarga Gergő2014-11-20 19:01:15részletek
61verbaline.huVerbaline Kft.2014-11-20 19:01:15részletek
62vicavirag.huÁbrahám Éva E.V.2014-11-20 19:01:15részletek
63almresort-gerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:14részletek
64glosbe.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
65teneues.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
66szikrasecurity.huKisari Ádám2014-11-20 19:01:14részletek
67darlingdekor.huKökényesi Ferenc Dániel2014-11-20 19:01:14részletek
68szamocakozpont.huSzabó Mónika2014-11-20 19:01:14részletek
69sopronibolcsodek.huBökönyi Norbert EV.2014-11-20 19:01:13részletek
70gobliners.huCsanádi Viktor2014-11-20 19:01:13részletek
71gasztroda.huSzőke Mihály István2014-11-20 19:01:13részletek
72keramixlighting.huKeramix Hungary Kft.2014-11-20 19:01:13részletek
73filmbackground.huFilm Background Kft.2014-11-20 19:01:13részletek
74foniciachange.huFőnicia Cash Change Kft2014-11-20 19:01:13részletek
75pesti-cola.huWalking Image Kft.2014-11-20 19:01:13részletek
76almresortgerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:12részletek
77samsonline.huVarga János2014-11-20 19:01:12részletek
78fogszabalyozas-otthon.huArany Generáció Kft.2014-11-20 19:01:12részletek
79herbatunder.huTelekom-Line Kft.2014-11-20 19:01:12részletek
80turbointercooler.huDomokos Péter2014-11-20 19:01:12részletek
81velenceistukko.huSipőcz Kft.2014-11-20 19:01:12részletek
82bbpragmatic.huBagyánszky Zoltán Márió2014-11-20 19:01:12részletek
83startupkft.huStart Up Kft.2014-11-20 19:01:11részletek
84luxusszonyeg.huVarga Gergő2014-11-20 19:01:11részletek
85plastidip-shop.huFlyR Reklámműhely kft2014-11-20 19:01:11részletek
86nyalás.huDiczkó Csaba2014-11-20 19:01:11részletek
87rolandkis.huKis Roland2014-11-20 19:01:11részletek
88mélytorok.huDiczkó Csaba2014-11-20 19:01:11részletek
89sofilux.huSofilux Kft.2014-11-20 19:01:11részletek
90viessmann-3d.huVIESSMANN Modellgyártó Kft2014-11-20 19:01:11részletek
91yuhuu.huHajnády Bence2014-11-20 19:01:10részletek
92pajerovalbamakoba.huDr. Szabó Kristóf2014-11-20 19:01:10részletek
93szocialisdepo.huMajoros Márta2014-11-20 19:01:10részletek
94terapiagyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:10részletek
95dugás.huDiczkó Csaba2014-11-20 19:01:10részletek
96i-partner.huPelican System Kft.2014-11-20 19:01:10részletek
97csakajokmennekel.huClassik Marketing Kft.2014-11-20 19:01:10részletek
98pic-studio.huGyőrfi András2014-11-20 19:01:09részletek
99hajszalhijjan-jog.huAnonymouse Domains s.r.o.2014-11-20 19:01:09részletek
100irodakraktarak.huHarkácsi István2014-11-20 19:01:09részletek
101aranyeda.huKoncz Edit2014-11-20 19:01:09részletek
102kompetenspedagogus.huArató Ferenc2014-11-20 19:01:09részletek
103dcfxbroker.huRozgonyi György2014-11-20 19:01:09részletek
104magmametal.huSzádvári Gábor 2014-11-20 19:01:09részletek
105danubelkwstore.huZsámbok János2014-11-20 19:01:08részletek
106marinagold.huGalaxis Világa Kft2014-11-20 19:01:08részletek
107atac.huATAC Informatikai, Kereskedelmi és Szolgáltató Kft.2014-11-20 19:01:08részletek
108itcegek.huwebformance Kft.2014-11-20 19:01:08részletek
109a-szalon.huUdvardi Péter2014-11-20 19:01:08részletek
110exertus.huExertus Trade Kft2014-11-20 19:01:08részletek
111szopás.huDiczkó Csaba2014-11-20 19:01:08részletek
112fx21.huRozgonyi György2014-11-20 19:01:08részletek
113a-part-man.huDél-Alföldi Turisztikai és Idegenforgalmi Szociális Szövetkezet2014-11-20 19:01:07részletek
114nanobikini.huPohl Veronika2014-11-20 19:01:07részletek
115videoakku.huSysinfo Kft.2014-11-20 19:01:07részletek
116gyoparos-terapia.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
117tetofedes-kaposvar.huRutai Sándor2014-11-20 19:01:07részletek
118butorbolt-cegled.huRutai Sándor2014-11-20 19:01:07részletek
119terapia-gyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
120ugytar.huBroadBit Hungary Kft.2014-11-20 19:01:07részletek
121otletvarazs.huFidus Company Bt2014-11-20 19:01:06részletek
122babauszas.co.huLonkai Adrienn2014-11-20 19:01:06részletek
123aeek.huUniweb Plusz Kft2014-11-20 19:01:06részletek
124pillaeskorom.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:06részletek
125idojaras-sopron.huHelyes Gábor2014-11-20 19:01:06részletek
126pharmekal.huWell-Form Kft.2014-11-20 19:01:06részletek
127amatőr-szex.huDiczkó Csaba2014-11-20 19:01:06részletek
128ledtvszerviz.huKomlós Zsolt2014-11-20 19:01:06részletek
129szamocapedagogia.huSzabó Mónika2014-11-20 19:01:05részletek
130timiesantal.huVarga Norbert2014-11-20 19:01:05részletek
131etablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:05részletek
132cegnevsor.huBártfai Balázs2014-11-20 19:01:05részletek
133mlmhivatas.huZseli Csaba2014-11-20 19:01:05részletek
134oletv.huWebenlét Kft.2014-11-20 19:01:05részletek
135nethazmester.huAradi László2014-11-20 19:01:05részletek
136muhely-titok.huFövenyi Györgyi2014-11-20 19:01:04részletek
137romaipartihirek.huRSE Római Part Nonprofit Kft.2014-11-20 19:01:04részletek
138egvkft.huÉGV Kft.2014-11-20 19:01:04részletek
139getsportjob.huWebsupport s.r.o.2014-11-20 19:01:04részletek
140gas-go.huGas-Go Magyarország Kft.2014-11-20 19:01:04részletek
141plancal.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:04részletek
142vacskamati.huSári Márton2014-11-20 19:01:04részletek
143tarsashazepito.huBertoja-Berend András2014-11-20 19:01:03részletek
144delfinkonyvek.huMaxim Könyvkiadó Kft.2014-11-20 19:01:03részletek
145urbanpm.huAdacta Systems Kft.2014-11-20 19:01:03részletek
146naszalymento.huViola Albert2014-11-20 19:01:03részletek
147e-tablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:03részletek
148fozomania.huVereb Adrienn2014-11-20 19:01:03részletek
149pesticola.huWalking Image Kft.2014-11-20 19:01:03részletek
150kamionreklam.huWalking Image Kft.2014-11-20 19:01:03részletek
151cammogo.huCreateam Reklámügynökség Kft2014-11-20 19:01:02részletek
152pomiversum.huKozalik Attila2014-11-20 19:01:02részletek
153korgforum.huDetvai Gyula2014-11-20 19:01:02részletek
154mercymolnar.huMolnár Ferenc2014-11-20 19:01:02részletek
155molnarmercy.huMolnár Ferenc2014-11-20 19:01:02részletek
156budapestiugyvediiroda.huDr. Fórizs Zsolt 2014-11-20 19:01:02részletek
157diszallatkutsera.huKutsera Balázs2014-11-20 19:01:01részletek
158gammaplus.huOstrogonac József2014-11-20 19:01:01részletek
159erintesfurdo.huKállai Éva Egyéni Vállalkozó2014-11-20 19:01:01részletek
160bellozzo.huFusion Befektetési Zrt.2014-11-20 19:01:01részletek
161romanticgardrob.huSiposné Geschitz Annamária e.v.2014-11-20 14:01:16részletek
162klinkercentrum.huTetőcentrum Magyarország Kft.2014-11-20 14:01:15részletek
163goldenstar.huPápai Petra2014-11-20 14:01:15részletek
164yoursclub.huCséfai Nóra2014-11-20 14:01:15részletek
165bptech.huMilassin András2014-11-20 14:01:15részletek
166miniapro.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
167kepfelho.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
168petmagic.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
169batyifc.huGombás Péter2014-11-20 14:01:15részletek
170vp-cloud.huGASORG Kft.2014-11-20 14:01:14részletek
171tabletpenztargep.huNazza Software Kft.2014-11-20 14:01:14részletek
172farkasfitness.huFarkas Gyula2014-11-20 14:01:14részletek
173lelekiranytu.huKovács Zsolt2014-11-20 14:01:14részletek
174teglasjohanna-webdesign.huTéglás Johanna2014-11-20 14:01:14részletek
175hantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:14részletek
176oszter.huMidani Nizar2014-11-20 14:01:14részletek
177naturdr.huVáradi Aranka2014-11-20 14:01:13részletek
178napviragszappan.huConwell Kft.2014-11-20 14:01:13részletek
179androidpenztargep.huNazza Software Kft.2014-11-20 14:01:13részletek
180dronkozpont.huFarkas István2014-11-20 14:01:13részletek
181nemzetiborbolt.huChateau Segesdi Kft.2014-11-20 14:01:13részletek
182nagy-szulejman.huTrivium Kiadó Kft.2014-11-20 14:01:13részletek
183simonhantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:13részletek
184alkus.huMeva Zsalurendszerek Zrt.2014-11-20 14:01:13részletek
185zselicsaba.huZseli Csaba2014-11-20 14:01:12részletek
186mvlvt.huSzatmári Szandra2014-11-20 14:01:12részletek
187vastalanito.huFürjesi Bálint2014-11-20 14:01:12részletek
188adsolute.huWebsupport s.r.o.2014-11-20 14:01:12részletek
189blackfridays.huNoname Domain Kft.2014-11-20 14:01:12részletek
190ajkarockband.huKrix Zoltán2014-11-20 14:01:12részletek
191pszbacs.huKrix Zoltán2014-11-20 14:01:12részletek
192itart.huSzták András2014-11-20 14:01:12részletek
193evilangel.huEuroDNS S.A.2014-11-20 14:01:11részletek
194pointsofyou.huD-LAB Consulting Kft.2014-11-20 14:01:11részletek
195azsiailanyok.huDiczkó Csaba2014-11-20 14:01:11részletek
196pandajatek.huRévész László2014-11-20 14:01:11részletek
197domainstartup.huMonitor Média Kft.2014-11-20 14:01:11részletek
198naszindito.huHatékony Konzultáns Kft.2014-11-20 14:01:11részletek
199unico.huKrix Zoltán2014-11-20 14:01:11részletek
200hazbolt.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
201tuzepshop.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
202csigakrem.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
203csigakrém.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
204ponstrik.huPONSTRIK Korlátolt Felelősségű Társaság2014-11-20 14:01:10részletek
205gazkeszulekbudapest.huIzsold János2014-11-20 14:01:10részletek
206csizmadiakftpapa.huCsizmadia és Társai Kft.2014-11-20 14:01:09részletek
207arnytechnika.huMimas System Kft2014-11-20 14:01:09részletek
208malimo.huRobonet BT2014-11-20 14:01:09részletek
209epitoaruhaz.huGerbner Dániel Ádám2014-11-20 14:01:09részletek
210wallies.huKrix Zoltán2014-11-20 14:01:09részletek
211budakeszikonyveloiroda.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:09részletek
212alsoorsiplebania.huAlsóörs Római Katolikus Plébánia2014-11-20 14:01:09részletek
213raktar-guru.huPethő Eszer2014-11-20 14:01:08részletek
214iroda-guru.huPethő Eszer2014-11-20 14:01:08részletek
215lukacsipapir.huLukácsi Mercédesz2014-11-20 14:01:08részletek
216ingatlan-guru.huPethő Eszer2014-11-20 14:01:08részletek
217webfunz.huNoname Domain Kft.2014-11-20 14:01:08részletek
218euphoriaorg.huTroll Gergő2014-11-20 14:01:08részletek
219irenkesegit.huMárkus Ágnes2014-11-20 14:01:08részletek
220okoskalandwebshop.huRigóné Plezsik Rita2014-11-20 14:01:08részletek
221gombnyomasra.huKaraba György2014-11-20 14:01:07részletek
222domainaffiliate.huMonitor Média Kft.2014-11-20 14:01:07részletek
223horvathszervizmihalyi.huBedi Ervin E.V.2014-11-20 14:01:07részletek
224nasker.huINFO-FUNDA Betéti Társaság2014-11-20 14:01:07részletek
225paycoin.huGanyecz Gábor2014-11-20 14:01:07részletek
226hungarytrip.huBenedek Csilla2014-11-20 14:01:07részletek
227biorezo.huLadányi Zsuzsanna2014-11-20 14:01:07részletek
228greenlandarea.huKovács Csaba2014-11-20 14:01:07részletek
229mah-pyrogas-kazan.huMészáros Attila2014-11-20 14:01:06részletek
230domainajanlatok.huMonitor Média Kft.2014-11-20 14:01:06részletek
231domainstreet.huMonitor Média Kft.2014-11-20 14:01:06részletek
232startupdomain.huMonitor Média Kft.2014-11-20 14:01:06részletek
233projektangyal.huEUROPROJEKT EGER Kft.2014-11-20 14:01:06részletek
234droidsecurity.huFarkas István2014-11-20 14:01:06részletek
235premiumbrikett.huS and P Trucks Kft2014-11-20 14:01:06részletek
236rendy.huRendes Gábor E.V.2014-11-20 14:01:05részletek
237onlinemegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
238emmt.huWebenlét Kft.2014-11-20 14:01:05részletek
239elsomagyarmegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
240boritekolas.huBártfai Balázs2014-11-20 14:01:05részletek
241budakeszikonyvelo.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:05részletek
242nagyszulejman.huTrivium Kiadó Kft.2014-11-20 14:01:05részletek
243esernyő-shop.huTóth Péter E.V.2014-11-20 14:01:04részletek
244egeszsegestudomany.huEgészség és Tudomány Bt.2014-11-20 14:01:04részletek
245galbalazs.huGál Balázs2014-11-20 14:01:04részletek
246feszek-ingatlan.huBooster Média Marketing Szolgáltató Kft.2014-11-20 14:01:04részletek
247fotoslany.huMegoldás Webügynökség Kft.2014-11-20 14:01:04részletek
248esikon.huD 180 Kft.2014-11-20 14:01:04részletek
249kisit.huKis Norbert2014-11-20 14:01:04részletek
250napikaja.huKánya Loránd2014-11-20 14:01:03részletek
251hintaló.huFehér Zsolt2014-11-20 14:01:03részletek
252roncs-licit.huSzugyiczki András2014-11-20 14:01:03részletek
253kajdicomputer.huKajdi Roland2014-11-20 14:01:03részletek
254roncsautoaukcio.huSzugyiczki András2014-11-20 14:01:03részletek
255dreamfotostudio.hudr Bereczky Orsolya2014-11-20 14:01:03részletek
256harsanyiistvandij.huManager Képzés Alapítvány2014-11-20 14:01:03részletek
257petzingercukraszat.huPetzinger Judit 2014-11-20 14:01:02részletek
258hiperhaver.huHiper-Aktív Family Kft2014-11-20 14:01:02részletek
259xplaykonzol.huMolnár Judit Egyéni vállalkozó2014-11-20 14:01:02részletek
260mvhshop.hu True Trade Kft. 2014-11-20 14:01:02részletek
261elitshop.huOpen Solutions Kft. 2014-11-20 14:01:02részletek
262wdconsulting.huWD Consulting Kft2014-11-20 14:01:02részletek
263fortepiano.huBalogh Csaba2014-11-20 14:01:02részletek
264evendi.hueVendi GmbH & Co. KG2014-11-20 14:01:01részletek
265boxbufe.huAFIS Kft.2014-11-20 14:01:01részletek
266fishntech.co.huCsiba Gergely2014-11-20 14:01:01részletek
267azzurracouture.huLuxuria Moda Kft2014-11-19 23:01:12részletek
268dugodijzona.huMedia Organisation Kft2014-11-19 23:01:12részletek
269dekanter.huKenyeres Mónika2014-11-19 23:01:12részletek
270schwarczattila.huDr. Schwarcz Attila2014-11-19 23:01:12részletek
271aroma-one.huAtlantis Systems, s.r.o.2014-11-19 23:01:11részletek
272taskacarp.huWebsupport s.r.o.2014-11-19 23:01:11részletek
273tibekacnc.huTibeka-Design Kft2014-11-19 23:01:11részletek
274reli.huHettich Zsolt2014-11-19 23:01:11részletek
275djrici.huCivil-Network.hu Kft,2014-11-19 23:01:11részletek
276csupaszmacska.huNagy-Ördög Csilla2014-11-19 23:01:11részletek
277monstertrucks.huParamount Pictures International2014-11-19 23:01:11részletek
278aromaone.huAtlantis Systems, s.r.o.2014-11-19 23:01:10részletek
279abde.huAlföld-Budapest-Dunántúl Felnőttképzési és Humánszolgáltató Egyesülés2014-11-19 23:01:10részletek
280dpelectro.huVértesi Outlet Kft.2014-11-19 23:01:10részletek
281kalamarbeata.huKalamár Beáta ev.2014-11-19 23:01:10részletek
282grill-sziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:10részletek
283sportmotivacio.huNyomárkay András2014-11-19 23:01:10részletek
284tesztapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
285startupp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
286startlapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
287sziviszovi.huIT DEPO Kft.2014-11-19 23:01:09részletek
288xconnections.huHPS Experience Kft.2014-11-19 23:01:09részletek
289ledekboltja.huGreen Plan Energy Kft 2014-11-19 23:01:09részletek
290grillsziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:09részletek
291impulsefitclub.huKisdaróczy Gábor2014-11-19 23:01:08részletek
292frenchbulldogs.huFlashdigital Bt.2014-11-19 23:01:08részletek
293it-happens.huIT-HAPPENS Kft.2014-11-19 23:01:08részletek
294voicegroup.huCyclick Kft.2014-11-19 23:01:08részletek
295elomult.huHortobágyi Ágoston2014-11-19 23:01:08részletek
296cocktailforever.huBencsik Szilveszter2014-11-19 23:01:08részletek
297sylviapartner.huBardovics Bt2014-11-19 23:01:07részletek
298silentmusic.huCyclick Kft.2014-11-19 23:01:07részletek
299szaboking.huSzabó Tibor2014-11-19 23:01:07részletek
300fejlesztot-keresek.huMolnár István2014-11-19 23:01:07részletek
301cedrusudvar.huCodemakers Kft2014-11-19 23:01:07részletek
302janafoto.huVarga-Kovács Janka 2014-11-19 23:01:07részletek
303oriassuti.huJónás Milán2014-11-19 23:01:07részletek
304felarak.huWebsupport s.r.o.2014-11-19 23:01:07részletek
305promedica.huB-ALL-MED Bt.2014-11-19 23:01:06részletek
306villamgrill.huJuhász Benjámin2014-11-19 23:01:06részletek
307sanpaolo.huKoffein-Futár Kft.2014-11-19 23:01:06részletek
308typhoontrade.huSzeles Szabolcs2014-11-19 23:01:06részletek
309almerabonto.huDemmel László2014-11-19 23:01:06részletek
310xmix.huEucalyptus Kft.2014-11-19 23:01:06részletek
311lakashotelek.huKovács Szabolcs Pál2014-11-19 23:01:05részletek
312verticalinverse.huSzénási Levente2014-11-19 23:01:05részletek
313galga-zagyva.huLantos Éva2014-11-19 23:01:05részletek
314zsuroteam.huIT DEPO Kft.2014-11-19 23:01:05részletek
315hamleys.co.huHamleys of London Ltd.2014-11-19 23:01:05részletek
316dolgosmama.huKovácsné Fenyõ Erzsébet2014-11-19 23:01:04részletek
317epitowebaruhaz.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
318tuzepbolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
319epitobolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
320lakashotel.huKovács Szabolcs Pál2014-11-19 23:01:04részletek
321mythosetterem.huDP Consultingroup KFT2014-11-19 23:01:04részletek
322taxinvestment.huTax Investment Kft.2014-11-19 23:01:03részletek
323képestok.huEz GSM Phone Kft.2014-11-19 23:01:03részletek
324ficurapacban.huFüzesséry Anikó2014-11-19 23:01:03részletek
325ficur.huFüzesséry Anikó2014-11-19 23:01:03részletek
326lakolap.huGerbner Dániel Ádám2014-11-19 23:01:03részletek
327netszakács.huUnger Tamás2014-11-19 23:01:03részletek
328formiko.huFormiko Kft2014-11-19 23:01:03részletek
329carlock.huCyclick Kft.2014-11-19 23:01:02részletek
330cilter.huCyclick Kft.2014-11-19 23:01:02részletek
331violetpiano.huViolet Piano Kft.2014-11-19 23:01:02részletek
332mojovibez.huFriendly Creative Agency Kft2014-11-19 23:01:02részletek
333baxalta.co.huBaxter Healthcare Corporation2014-11-19 23:01:02részletek
334dunamentiborok.huWebsupport s.r.o.2014-11-19 19:01:23részletek
335radioaktivpecs.huKrix Zoltán2014-11-19 19:01:22részletek
336zoutube.huWebsupport s.r.o.2014-11-19 19:01:22részletek
337uvegfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:22részletek
338veddaszarnyaidala.huACG Reklámügynökség Kft.2014-11-19 19:01:22részletek
339duphalac.huAbbott Laboratories (Magyarország) Kft.2014-11-19 19:01:22részletek
340kriszwebdesign.huErdélyi Krisztián2014-11-19 19:01:22részletek
341darwin-tol-istenig.huAnonymouse Domains s.r.o.2014-11-19 19:01:22részletek
342jbdesign.huMihalics Bernadett2014-11-19 19:01:22részletek
343scop.huCOP Rendszertechnika Kft.2014-11-19 19:01:22részletek
344gamberhosting.huKrix Zoltán2014-11-19 19:01:21részletek
345otyliastyle.huSőrés Ottilia2014-11-19 19:01:21részletek
346lenartgrafika.huLénárt Viktor2014-11-19 19:01:21részletek
347fuggonyfalak.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
348fuggonyfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
349fuggonyfal.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
350sportoutletshop.huKatona Dániel2014-11-19 19:01:21részletek
351aceremoniakmestere.huKiss Dániel2014-11-19 19:01:21részletek
352proxyszerver.hueForce Informatikai és Kereskedelmi Kft.2014-11-19 19:01:21részletek
353fritzland.huHorváth-Hegyi Dénes2014-11-19 19:01:21részletek
354abasariterko.huAbasári Nonprofit Településüzemeltetési és Fejlesztési Kft. 2014-11-19 19:01:20részletek
355webdesignsolution.huVisnyocki Norbert2014-11-19 19:01:20részletek
356webdesignart.huVoleszák-Szabó Anita2014-11-19 19:01:20részletek
357prixa.huPausch Rita2014-11-19 19:01:20részletek
35811web.huDanyi László2014-11-19 19:01:20részletek
359pere-design.huPerényi Dániel2014-11-19 19:01:20részletek
360spiritfitness.huSisák Zoltán2014-11-19 19:01:20részletek
361abasarioltvany.huAbasár Község Önkormányzata2014-11-19 19:01:20részletek
362fortuna-ingatlan.huFortuna Ingatlan és Hiteliroda2014-11-19 19:01:20részletek
363zselicvendeghaz.huField & Forest Kft.2014-11-19 19:01:19részletek
364gazhalozatszerelo.huFarkas Zsolt2014-11-19 19:01:19részletek
365vizfutes.huTóth Ferenc2014-11-19 19:01:19részletek
366sarahazavendeghaz.huHerczeg Krisztina2014-11-19 19:01:19részletek
367miswak.huWebsupport s.r.o.2014-11-19 19:01:19részletek
368webedinadesign.huRobin és Társa Bt.2014-11-19 19:01:19részletek
369jazminpakoca.huRemetei Tamás2014-11-19 19:01:19részletek
370idezetshop.huFeki Webstudio Kft.2014-11-19 19:01:18részletek
371liftkamerak.huBolemányi Tibor E.V2014-11-19 19:01:18részletek
372onehundred.huE-LEVEN 2003 Kereskedelmi és Szolgáltató Kft.2014-11-19 19:01:18részletek
373fizessokosan.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
374smartpay.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
375happyfoodcoffee.huHappy Food & Coffee Kft2014-11-19 19:01:18részletek
376horgolt.huCogitate Games Kft.2014-11-19 19:01:18részletek
377mukoromzsele.huGombos Alex2014-11-19 19:01:18részletek
378prenome.huCene Judit2014-11-19 19:01:17részletek
379ravenololaj.huSCT Hungary Kft2014-11-19 19:01:17részletek
380diszkontcsempe.huHorváth András2014-11-19 19:01:17részletek
381altershop.huVincze Dávid2014-11-19 19:01:17részletek
382bontottarbanujalkatresz.huSH Group Kft.2014-11-19 19:01:17részletek
383idezettar.huFeki Webstudio Kft.2014-11-19 19:01:17részletek
384mstyle.huSzabóné Molnár Mónika Éva2014-11-19 19:01:17részletek
385fler.huKrix Zoltán2014-11-19 19:01:16részletek
386pemcoolaj.huSCT Hungary Kft2014-11-19 19:01:16részletek
387pemco.huSCT Hungary Kft2014-11-19 19:01:16részletek
388blackcode.huVerhás Dániel2014-11-19 19:01:16részletek
389brikettgyar.huBrikettpont Kft.2014-11-19 19:01:16részletek
390pinkrock.huPink Rock Investor Relations Kft.2014-11-19 19:01:16részletek
391kelloggsvantage.huKellogg Europe Trading Limited2014-11-19 19:01:16részletek
392szenioreletmod.huLesko Márk2014-11-19 19:01:16részletek
393wmaps.huKrix Zoltán2014-11-19 19:01:15részletek
394kották.huCsipai Roland2014-11-19 19:01:15részletek
395onlinemarketingugynokseg.huMolnár Dániel Ders2014-11-19 19:01:15részletek
396beeboo.huTanyik Adrienn2014-11-19 19:01:15részletek
397kutyaneveknevnapok.huNagy Gábor2014-11-19 19:01:15részletek
398csipetnyidesign.huVisztricz Petra2014-11-19 19:01:15részletek
399nyugdijgondoskodas.huMesszi-Szabó Gábor2014-11-19 19:01:15részletek
400hpu.huUnidomain Kft.2014-11-19 19:01:15részletek
401babeldelicate.huKrix Zoltán2014-11-19 19:01:14részletek
402eciconf-2012.huKrix Zoltán2014-11-19 19:01:14részletek
403konnyentanulas.huKrix Zoltán2014-11-19 19:01:14részletek
404almamania.huKrix Zoltán2014-11-19 19:01:14részletek
405kamion-alkatresz.huVér József2014-11-19 19:01:14részletek
406sungardenszolarium.huNeusch Csaba2014-11-19 19:01:14részletek
407fuggonyfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:14részletek
408kutyanevek-nevnapok.huNagy Gábor2014-11-19 19:01:14részletek
409zsoltrozsnyai.huRozsnyai Zsolt2014-11-19 19:01:14részletek
410tiszariver.huKrix Zoltán2014-11-19 19:01:13részletek
411lightandnature.huKrix Zoltán2014-11-19 19:01:13részletek
412designdistrict.huKrix Zoltán2014-11-19 19:01:13részletek
413mmsklub.huKrix Zoltán2014-11-19 19:01:13részletek
414repulogepemlekpark.huKrix Zoltán2014-11-19 19:01:13részletek
415koltsegcsokkento.huUnidomain Kft.2014-11-19 19:01:13részletek
416atecuccod.huAkrouf Design Kft2014-11-19 19:01:13részletek
417foto64.huBarna Buxbaum2014-11-19 19:01:13részletek
418retailhungary.huMajor Krisztina e.v.2014-11-19 19:01:12részletek
419oharom.huKrix Zoltán2014-11-19 19:01:12részletek
420a01.huKrix Zoltán2014-11-19 19:01:12részletek
421pos-digital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
422posdigital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
423g-styleforyou.huMuhi Gabriella2014-11-19 19:01:12részletek
424phantomsmoke.huJoker Busz Travel Kft.2014-11-19 19:01:12részletek
425ujszilvasiskola.huTápiószőlős-Újszilvás Ref. Ált. Isk. és Óvoda2014-11-19 19:01:12részletek
426hardwareonline.huKrix Zoltán2014-11-19 19:01:11részletek
427soproniingatlan.huKrix Zoltán2014-11-19 19:01:11részletek
428computerpanorama.huKrix Zoltán2014-11-19 19:01:11részletek
429butorszerelok.huKrix Zoltán2014-11-19 19:01:11részletek
430hnkozetkeztetes.huTóth Imre2014-11-19 19:01:11részletek
431aceremoniakmesterei.huKiss Dániel2014-11-19 19:01:11részletek
432upmicro.huKrix Zoltán2014-11-19 19:01:10részletek
433gondolkodjunkegyutt.huKrix Zoltán2014-11-19 19:01:10részletek
434mics.huMICS-LINE Szolgáltató Bt.2014-11-19 19:01:10részletek
435mindenholhal.huSzarvas-Fish Kft.2014-11-19 19:01:10részletek
436krisztidesign.huSzelényi Krisztina2014-11-19 19:01:10részletek
437sipostibor.huSipos Tibor2014-11-19 19:01:10részletek
438beugrok.huSZIGETKÖZ.NET Kft.2014-11-19 19:01:10részletek
439gyemanthomoki.huKrix Zoltán2014-11-19 19:01:09részletek
440jeebalaton.huKrix Zoltán2014-11-19 19:01:09részletek
441kuponajandeka.huKrix Zoltán2014-11-19 19:01:09részletek
442hunyatefu.huKrix Zoltán2014-11-19 19:01:09részletek
443meccskozpont.huKrix Zoltán2014-11-19 19:01:09részletek
444likeface.huKrix Zoltán2014-11-19 19:01:09részletek
445itacademy.huKrix Zoltán2014-11-19 19:01:09részletek
446egercity.huKrix Zoltán2014-11-19 19:01:09részletek
447deathfellows.huKrix Zoltán2014-11-19 19:01:08részletek
448budaiborszalon.huKrix Zoltán2014-11-19 19:01:08részletek
449webrain.huKrix Zoltán2014-11-19 19:01:08részletek
450xxl-tuning.huKrix Zoltán2014-11-19 19:01:08részletek
451maszosz.huKrix Zoltán2014-11-19 19:01:08részletek
452hetret.huKrix Zoltán2014-11-19 19:01:08részletek
453aspentravel.huKrix Zoltán2014-11-19 19:01:08részletek
454ubmmedica.huKrix Zoltán2014-11-19 19:01:08részletek
455szexshop-hungary.huKrix Zoltán2014-11-19 19:01:07részletek
4562zsiraf.huKrix Zoltán2014-11-19 19:01:07részletek
457fullarts.huKrix Zoltán2014-11-19 19:01:07részletek
458magyarrss.huKrix Zoltán2014-11-19 19:01:07részletek
459sexdating.huKrix Zoltán2014-11-19 19:01:07részletek
460vasutihid.huKrix Zoltán2014-11-19 19:01:07részletek
461fogadaspont.huKrix Zoltán2014-11-19 19:01:07részletek
462idezetbolt.huFeki Webstudio Kft.2014-11-19 19:01:07részletek
463dignity.huEmberi Méltóság Központ2014-11-19 19:01:06részletek
464idezetportal.huFeki Webstudio Kft.2014-11-19 19:01:06részletek
465poo-pourri.huSeducanto s.r.o.2014-11-19 19:01:06részletek
466katkawebdesign.huNagy Katalin2014-11-19 19:01:06részletek
467celeris.huUnidomain Kft.2014-11-19 19:01:06részletek
468zoldhazak.huSilicium Network Kft. (Registrar)2014-11-19 19:01:06részletek
469teljeselmesalkotas.huBihari László2014-11-19 19:01:06részletek
470kzsdesign.huKozák Zsanett2014-11-19 19:01:05részletek
471szingli-fesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
472szinglifesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
473speed-fittness.huVér József2014-11-19 19:01:05részletek
474gyermekmegtakaritas.huMesszi-Szabó Gábor2014-11-19 19:01:05részletek
475train4gain.huTrainforgain Kft2014-11-19 19:01:05részletek
476conphone.huConPhone Audio Conferening Kft.2014-11-19 19:01:05részletek
477goodmorningbudapest.huKrix Zoltán2014-11-19 19:01:04részletek
478m35.huUndefasa Kft. 2014-11-19 19:01:04részletek
479epishop.huWildenert s.r.o.2014-11-19 19:01:04részletek
480mikroszoft.huMikroszoft Fejlesztő és Kereskedelmi Kft.2014-11-19 19:01:04részletek
481googlebolt.huMegaline Stúdió Kft.2014-11-19 19:01:04részletek
482hifanovenyvedoszerkereskedelem.huZEMPLÉN-MAG Kft.2014-11-19 19:01:04részletek
483datacontrol.huUnidomain Kft.2014-11-19 19:01:04részletek
484bigdog.huPintyéné Deák Anita2014-11-19 19:01:03részletek
485packplus.huDS Smith Packaging Hungary Kft2014-11-19 19:01:03részletek
486hopika.huIllyés Dezsõ2014-11-19 19:01:03részletek
487josef.huUnidomain Kft.2014-11-19 19:01:03részletek
488oriasmuffin.huJónás Milán2014-11-19 19:01:03részletek
489legvar60.huBertók Máté2014-11-19 19:01:03részletek
490cserkoakku.huCserné Radonics Piroska2014-11-19 19:01:03részletek
491technosport.huKrix Zoltán2014-11-19 19:01:02részletek
492uvegfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:02részletek
493vedoszarny.huACG Reklámügynökség Kft.2014-11-19 19:01:02részletek
494moltatech.huMOLTA-TECH Bt.2014-11-19 19:01:02részletek
495ktva.huKözép-Tiszai Vidékfejlesztő Alapítvány2014-11-19 19:01:02részletek
496toltoanyag.huDunaCom Plus Kft.2014-11-19 19:01:02részletek
497digitalis-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-19 19:01:02részletek
498onlinemarketingügynökség.huMolnár Dániel Ders2014-11-19 19:01:01részletek
499aranypart.huCetinje s.r.o.2014-11-19 19:01:01részletek
500cegledpartner.huKonrext Kft.2014-11-19 19:01:01részletek
501gombsulyzo.huIllés László2014-11-19 14:01:22részletek
502jumbomedia.huSzabó Tamás2014-11-19 14:01:22részletek
503feloras.huCsontos István2014-11-19 14:01:22részletek
504gyogynoveny.info.huGomoa Trade Kft2014-11-19 14:01:22részletek
505kozosenmagyarorszagert.huKirály Béla2014-11-19 14:01:21részletek
506diamond-lift.huSipos László2014-11-19 14:01:21részletek
507keretklub.huFinalArt Studio Kft.2014-11-19 14:01:21részletek
508karacsony2014.huMészáros Gábor2014-11-19 14:01:21részletek
509leglibor.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:21részletek
510fogyizo.huTerra Herba Kft.2014-11-19 14:01:21részletek
511salatagyar-eletmod-shop.huFITTBÁZIS Életmód Bt.2014-11-19 14:01:21részletek
512wwair.huEuroDNS S.A.2014-11-19 14:01:21részletek
513koborgo.huKiss Imre E.V.2014-11-19 14:01:20részletek
514modellking.huSzilágyi János2014-11-19 14:01:20részletek
515aquaponic-system.huCsiba Gergely2014-11-19 14:01:20részletek
516fishntech.huCsiba Gergely2014-11-19 14:01:20részletek
517aqua-ponia.huCsiba Gergely2014-11-19 14:01:20részletek
518viz-urb.huVarga Imre Zoltán2014-11-19 14:01:20részletek
519ehko.huEhKo Sign Industries Kft.2014-11-19 14:01:20részletek
520legliotto.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:20részletek
521factoryoutlet.huIT Computer Trading Kft.2014-11-19 14:01:19részletek
522vegasburger.huHolló Zsuzsanna2014-11-19 14:01:19részletek
523forthekids.huDenke Dániel2014-11-19 14:01:19részletek
524watersafe-system.huCsiba Gergely2014-11-19 14:01:19részletek
525watersafe.huCsiba Gergely2014-11-19 14:01:19részletek
526aquaponics-system.huCsiba Gergely2014-11-19 14:01:19részletek
527legliszolobirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:19részletek
528gravirfalva.huKovács Szabolcs2014-11-19 14:01:19részletek
529franciaforditas.huKiss-Boros Beatrix2014-11-19 14:01:18részletek
530csavartrade.huVass István2014-11-19 14:01:18részletek
531likebaby.huDevron-Impex Kft2014-11-19 14:01:18részletek
532nuvita.huDevron-Impex Kft2014-11-19 14:01:18részletek
533chipolino.huDevron-Impex Kft2014-11-19 14:01:18részletek
534espiro.huDevron-Impex Kft2014-11-19 14:01:18részletek
535babydesign.huDevron-Impex Kft2014-11-19 14:01:18részletek
536leglibirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:18részletek
537ceremoniakmesterei.huKiss Dániel2014-11-19 14:01:17részletek
538gymready.huKatschthaler Gabriella2014-11-19 14:01:17részletek
539o3clean.huNezvál Gergely2014-11-19 14:01:17részletek
540erdino.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
541erdinopont.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
542cleverframe.huLeme Kft2014-11-19 14:01:17részletek
543kalapozz.huMészáros Gábor2014-11-19 14:01:17részletek
544mobilsign.huMuhari Gábor2014-11-19 14:01:17részletek
545ceremoniakmestere.huKiss Dániel2014-11-19 14:01:16részletek
546femme.huSzmola Erika2014-11-19 14:01:16részletek
547aszemelyisoforod.huSzmola Erika2014-11-19 14:01:16részletek
548info-központ.huMéta Kereskedelmi Kft.2014-11-19 14:01:16részletek
549repulospajz.huFarkas Andrea2014-11-19 14:01:16részletek
550mogyorodiautosiskola.huHegedűs Vazul2014-11-19 14:01:16részletek
551reneszanszajandek.huReneszánsz Panoptikum Kft.2014-11-19 14:01:16részletek
552revkft.huRÉV Kft.2014-11-19 14:01:16részletek
553munkaruhamester.huHorváth Arszlán2014-11-19 14:01:16részletek
554igazmese.huKiss Erzsébet2014-11-19 14:01:15részletek
555szablyavivas.huBalogh Attila2014-11-19 14:01:15részletek
556officefitness.huNémeti Zoltán2014-11-19 14:01:15részletek
557networkhost.huKerékgyártó József2014-11-19 14:01:15részletek
558mammutneckermannsport.huPartner Kft.2014-11-19 14:01:15részletek
559zoldkalocsa.huKeiok Kft.2014-11-19 14:01:15részletek
560euronyelviskola.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:15részletek
561ho-ho.huNagyné Herczeg Eszter2014-11-19 14:01:15részletek
562ritauzlethaz.huIMMOWIT Kft.2014-11-19 14:01:14részletek
563321car.huHofer Sándor2014-11-19 14:01:14részletek
564raktaroid.huPickermann Adél2014-11-19 14:01:14részletek
565ozoneclean.huNezvál Gergely2014-11-19 14:01:14részletek
566de24.huBencsik Szilveszter2014-11-19 14:01:14részletek
567neoworks.huBosnyák Péter2014-11-19 14:01:14részletek
568szentmiklosparkfalu.huJUKO Kft.2014-11-19 14:01:14részletek
569sensationstyling.huSensation Styling Kft2014-11-19 14:01:13részletek
570maganerdesz.huHorváth Gábor2014-11-19 14:01:13részletek
571smartinstall.huSmart Install Kft.2014-11-19 14:01:13részletek
572demokratikusminimum.huHraskó Gábor Tamás2014-11-19 14:01:13részletek
573devizatanfolyam.huSolidusfx Trading Kft.2014-11-19 14:01:13részletek
574ameddosegellen.huSzmola Erika2014-11-19 14:01:13részletek
575gmtscomm.huGMTS COMM Kft2014-11-19 14:01:13részletek
576frendywendy.huGebi Hungary Kft2014-11-19 14:01:13részletek
577kekeper.huKovács Zoltán EV2014-11-19 14:01:13részletek
578varazshangulat.huPilling Tünde2014-11-19 14:01:12részletek
579winedesign.huNotrix-Magyarország Kft2014-11-19 14:01:12részletek
580patavafa.huVas János 2014-11-19 14:01:12részletek
581factory-outlet.huIT Remarketing Kft.2014-11-19 14:01:12részletek
582nyelvtanfolyam-online.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:12részletek
583moire.huFinalArt Studio Kft.2014-11-19 14:01:12részletek
584karmakeramia.huYellow Consulting Kft.2014-11-19 14:01:12részletek
585baxalta.huCorporation Service Company (UK) Limited 2014-11-19 14:01:12részletek
586gyukadental.huGyuka-Dental Kft.2014-11-19 14:01:11részletek
587obucity.huAuto Securit Zrt.2014-11-19 14:01:11részletek
588fashionizer.huSCHWABEN CONSULTING Bt.2014-11-19 14:01:11részletek
589egerhonlapkeszites.huBotos Regina2014-11-19 14:01:11részletek
590ugyvedmiskolc.hudr Harsányi Ádám Marcell2014-11-19 14:01:11részletek
591csudarumli.huBencsik Szilveszter2014-11-19 14:01:11részletek
592budapestartweekend.huBérczi Linda2014-11-19 14:01:11részletek
593refiper.huCserháti Ferenc2014-11-19 14:01:11részletek
594aszesz2003kft.huÁSZ-ÉSZ 2003 Gazdasági Szolgáltató és Építészeti Kft2014-11-19 14:01:10részletek
595idromatic.huNatur Wash Kft.2014-11-19 14:01:10részletek
596europacantat.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:10részletek
597gomarketmail.huWebmédia Market Kft.2014-11-19 14:01:10részletek
598pillemano.huErdész-Márkus Anita2014-11-19 14:01:10részletek
599vizmernok.huKristóf Csaba2014-11-19 14:01:10részletek
600szolnoktar.huVerseghy Ferenc Könyvtár és Közművelődési Intézmény2014-11-19 14:01:10részletek
601lelekvarazslat.huPilling Tünde2014-11-19 14:01:09részletek
602kockerd.huSzilágyi Antal2014-11-19 14:01:09részletek
603europacantatpecs.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:09részletek
604specops.huSpecops Hungary Kft.2014-11-19 14:01:09részletek
605drharsanyi.hudr Harsányi Ádám Marcell2014-11-19 14:01:09részletek
606parlagisasalapitvany.hu Parlagi Sas Alapítvány2014-11-19 14:01:09részletek
607sorsfutar.huRatkai Dávid2014-11-19 14:01:09részletek
608fodel.huHofer Sándor2014-11-19 14:01:08részletek
609jumbómédia.huSzabó Tamás2014-11-19 14:01:08részletek
610jumbó.huSzabó Tamás2014-11-19 14:01:08részletek
611csavarplusz.huHajas Gábor Péter2014-11-19 14:01:08részletek
612tietokone.huTietokone Kft.2014-11-19 14:01:08részletek
613creativejob.co.huFarkasfalvi Balázs2014-11-19 14:01:08részletek
614vízmérnök.huKristóf Csaba2014-11-19 14:01:08részletek
615clearplanet.huClear Planet Zrt.2014-11-19 14:01:08részletek
61610en.huEuroCable Magyarorszag Kft.2014-11-19 14:01:07részletek
617nemesfoto.huNemes Zoltán2014-11-19 14:01:07részletek
618hangulatvarazs.huPilling Tünde2014-11-19 14:01:07részletek
619gebi.huGebi Hungary Kft2014-11-19 14:01:07részletek
620ezteszed.huGórász Gréta2014-11-19 14:01:07részletek
621mesterhegedu.huLakatos Anna2014-11-19 14:01:07részletek
622hontvari.huKovácsné Hontvári Krisztina2014-11-19 14:01:07részletek
623kross-kerekpar.huBartusné Petkó Marietta2014-11-19 14:01:07részletek
624citygardens.huE-Building kft 2014-11-19 14:01:06részletek
625akkuport.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
626akkuzona.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
627baromfitragya.huTóth Attila2014-11-19 14:01:06részletek
628pillangocsoport.huAlacs Edina2014-11-19 14:01:06részletek
629glitter.huPekárovics Gábor2014-11-19 14:01:06részletek
630balazska.huFöldházi Balázs2014-11-19 14:01:06részletek
631fittmoka.huGolden Highway KFT2014-11-19 14:01:05részletek
632gromatea.huGrófi Major Kft.2014-11-19 14:01:05részletek
633eumail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
634hungarymail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
635intermail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
636konyvtenger.huTimár Mátyás2014-11-19 14:01:05részletek
637apartmango.huIstvándi János2014-11-19 14:01:05részletek
638teaworld.huKamala Kft.2014-11-19 14:01:04részletek
639fitmoka.huGolden Highway KFT2014-11-19 14:01:04részletek
640anzix-art.huDeák-Fogarasi István2014-11-19 14:01:04részletek
641newera.huOlcsváry Rudolf2014-11-19 14:01:04részletek
6422box.huMindOn Solutions Kft.2014-11-19 14:01:04részletek
643herbariabalance.huChrien Károly2014-11-19 14:01:04részletek
644welovelashes.huMáté Ágnes2014-11-19 14:01:04részletek
645sleader.huRózsa Péter2014-11-19 14:01:03részletek
646petofiudszov.hu"Petőfi" Üdülőszövetkezet2014-11-19 14:01:03részletek
647metropolcenter.huMetropol Center Kft2014-11-19 14:01:03részletek
648oatmealqueen.huGőkler András2014-11-19 14:01:03részletek
649fish-n-tech.huCsiba Gergely2014-11-19 14:01:03részletek
650blackdiamondportfolio.huGold Trader & Co. Befektetési Ügynökség Kft.2014-11-19 14:01:03részletek
651monostorikaposzta.huChrien Károly2014-11-19 14:01:03részletek
652frendy.huGebi Hungary Kft2014-11-19 14:01:02részletek
653aquaponic.huCsiba Gergely2014-11-19 14:01:02részletek
654fish-n-tech.co.huCsiba Gergely2014-11-19 14:01:02részletek
655szemle.huBelvedere Meridionale Kft.2014-11-19 14:01:02részletek
656kutklima.huKeresztes László2014-11-19 14:01:02részletek
657freshmood-design.huCsapó Zsuzsanna2014-11-18 23:01:24részletek
658vrszemuveg.huSánta Sándor2014-11-18 23:01:24részletek
659vrszemuvegek.huSánta Sándor2014-11-18 23:01:24részletek
660istvankalmar.huKalmár István2014-11-18 23:01:24részletek
661probaljki.huPannon-Servus Kft.2014-11-18 23:01:24részletek
662devsociety.huProject029 Media and Communications Kft.2014-11-18 23:01:24részletek
663restauratorart.huGyöpös Viktória2014-11-18 23:01:23részletek
664plac.huM&D Holding Kft2014-11-18 23:01:23részletek
665eva-blog.huBerecz Istvánné2014-11-18 23:01:23részletek
666netkazanok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:23részletek
667bachcseppek.huÉden-Esszencia Kft2014-11-18 23:01:23részletek
668asztrologia24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
669biztositas24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
670adamsegedeszkoz.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:23részletek
671mester-fok.huSzabó Attila2014-11-18 23:01:22részletek
672yuhu.huNoname Domain Kft.2014-11-18 23:01:22részletek
673imcsi.huKöő Imre2014-11-18 23:01:22részletek
674netkandallok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:22részletek
675ujrendszervaltas.huNoname Domain Kft.2014-11-18 23:01:22részletek
676vrjatekok.huSánta Sándor2014-11-18 23:01:22részletek
677vrshop.huSánta Sándor2014-11-18 23:01:22részletek
678kontinum.huKONTINUM Kft.2014-11-18 23:01:21részletek
679digitalmc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
680digital-mc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
681vrbolt.huSánta Sándor2014-11-18 23:01:21részletek
682louisxivenergy.huMucsi Gergely2014-11-18 23:01:21részletek
683feketezzunk.huEgyütt az Iskoláért Alapítvány2014-11-18 23:01:21részletek
684grafikaszak.huHurton Tamás2014-11-18 23:01:20részletek
685vcoin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:20részletek
686körsál.huSütő-Nagy Borbála2014-11-18 23:01:20részletek
687liquidsafe.huiHelpTrading Kft.2014-11-18 23:01:20részletek
688annadesign.huPataki Annamária2014-11-18 23:01:20részletek
689f50divataru.huTóth Anita2014-11-18 23:01:20részletek
690gyerekágybolt.huNapjaink Kft.2014-11-18 23:01:20részletek
691drvacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:19részletek
692paytransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
693vtransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
694payaccounts.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
695accountspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
696cardless.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
697gyerekagybolt.huNapjaink Kft.2014-11-18 23:01:19részletek
698postpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
699vpospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
700vcredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
701apay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
702billpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
703coinpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
704yaleszefek.huDimat Fűtéstechnika Kft2014-11-18 23:01:18részletek
705acci.huZ-Terv Stúdió Kft.2014-11-18 23:01:18részletek
706ezustpallos.huBodnár Balázs2014-11-18 23:01:17részletek
707asztalos-keszthely.huBIOFA-GYENES Kft2014-11-18 23:01:17részletek
708payin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
709payout.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
710hpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
711hunpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
712napellenzocentrum-gyor.huNapellenző Centrum Árnyékolástechnikai Kft. 2014-11-18 23:01:17részletek
713fogcomputing.huFaragó Róbert2014-11-18 23:01:17részletek
714hungarizalj.huSzabó Balázs Ev.2014-11-18 23:01:16részletek
715vacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
716vacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
717antiokostelefon.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
718antismartphone.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
719moneypay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
720pospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
721cardlesspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
722autojot.huOzsváth János2014-11-18 23:01:15részletek
723project2501.huKlenóczki Norbert2014-11-18 23:01:15részletek
724traktortrade.huTraktor Trade Kft2014-11-18 23:01:15részletek
725autogumi24net.huminden24 Információ Kft2014-11-18 23:01:15részletek
726autojaertkeszpenzazonnal.huA111 Autó Kft.2014-11-18 23:01:15részletek
727jarmuvetel.huA111 Autó Kft.2014-11-18 23:01:15részletek
728adamklinika.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:15részletek
729kitsimono.huTirpák Bálint Gábor2014-11-18 23:01:14részletek
730nagyt0mi.huNagy Tamás2014-11-18 23:01:14részletek
731biofa-gyenes.huBIOFA-GYENES Kft2014-11-18 23:01:14részletek
732deb-habszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:14részletek
733sungardenszalon.huNeusch Csaba2014-11-18 23:01:14részletek
734allattartovagyok.hu4SZS Kft.2014-11-18 23:01:14részletek
735bernover.huAmbulance Medical Kft.2014-11-18 23:01:14részletek
736geopolitics.huWiking Számítástechnika Kft2014-11-18 23:01:13részletek
737pendienda.huÖKO-Technika Bt.2014-11-18 23:01:13részletek
738electra-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:13részletek
739ambulanciaspolo.huAmbulance Medical Kft.2014-11-18 23:01:13részletek
740peterszalay.huSzalay Péter2014-11-18 23:01:13részletek
741onemanbandmusic.huMészáros Zoltán 2014-11-18 23:01:13részletek
742deb-szappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
743debhabszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
744rockpubcafe.huDoor2World Bt.2014-11-18 23:01:12részletek
745rockpub.huDoor2World Bt.2014-11-18 23:01:12részletek
746ptewebprint.huBalla Dávid2014-11-18 23:01:12részletek
747humydry.huEuroDNS S.A.2014-11-18 23:01:12részletek
748atrinova.huDespa Trust Kft.2014-11-18 23:01:12részletek
749sj4000sportkamera.huElectropoint Kft.2014-11-18 23:01:11részletek
750neocasa.huHalla Krisztina2014-11-18 23:01:11részletek
751vteshungariangrandprix.huNémeth Zoltán2014-11-18 23:01:11részletek
752swine.huRadnai László2014-11-18 23:01:11részletek
753ertekekhaza.huSzimbiózis a Harmonikus Együtt-létért Alapítvány2014-11-18 23:01:11részletek
754bacsa-konyvelokft.huBacsa-Könyvelő Kft.2014-11-18 23:01:11részletek
755monimi.huSkodákné Krizsán Mónika2014-11-18 23:01:11részletek
756ambupolo.huAmbulance Medical Kft.2014-11-18 23:01:11részletek
757unitedline.huKovács Miklós2014-11-18 23:01:10részletek
758medi-coach.huSzegény Beatrix2014-11-18 23:01:10részletek
759futopanelaruhaz.huPelle és Pelle Kft.2014-11-18 23:01:10részletek
760alomgardrob.huKoch-Babics Éva2014-11-18 23:01:10részletek
761dobosarnyekolastechnika.huDobos József ev.2014-11-18 23:01:10részletek
762paycredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:10részletek
763amedical.huAmbulance Medical Kft.2014-11-18 23:01:10részletek
764tarsalkodok.huPásztor László2014-11-18 23:01:10részletek
765debszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:09részletek
766horgasztaborok.huGeicz-Molnár Szilvia2014-11-18 23:01:09részletek
767napitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:09részletek
768iparifutesek.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
769futopaneluzlet.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
770kinesiology-tape.huM and M Interconsulting Bt.2014-11-18 23:01:09részletek
771europe-motion.huEurope Motion Kft.2014-11-18 23:01:09részletek
772hondakalogep.huKaló István2014-11-18 23:01:09részletek
773bolho.huBolhó Község Önkormányzata2014-11-18 23:01:08részletek
774tenderhirek.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
775dxnmegoldas.huCA Megoldás Kft.2014-11-18 23:01:08részletek
776anapitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
777napi-tender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
778jovofutese.huPelle és Pelle Kft.2014-11-18 23:01:08részletek
779brandfriends.huTóth Balázs2014-11-18 23:01:08részletek
780nyeremenycenter.huVisual Media Kft.2014-11-18 23:01:08részletek
781budavara.huTredit-SOL Kft.2014-11-18 23:01:07részletek
782digitalis-emlekmentes.huVarga János2014-11-18 23:01:07részletek
783kineziologiai-tapasz.huM and M Interconsulting Bt.2014-11-18 23:01:07részletek
784drvacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:07részletek
785nobore.huNobore kft2014-11-18 23:01:07részletek
786akciok-kedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:06részletek
787bvda.huTredit-SOL Kft.2014-11-18 23:01:06részletek
788habi-epker.huHabi-Épker Kft.2014-11-18 23:01:06részletek
789glimark.huKovács Imre2014-11-18 23:01:06részletek
790randivideo.huNoname Domain Kft.2014-11-18 23:01:06részletek
791akciokkedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:05részletek
792foresightsports.huNoramtech Bt.2014-11-18 23:01:05részletek
793orangeoil.huDom West Kft2014-11-18 23:01:05részletek
794burgpalast.huTredit-SOL Kft.2014-11-18 23:01:05részletek
795velenceitavieskuvok.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
796velenceitavieskuvo.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
797modernkaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:05részletek
798vgeotechnika.huVincze-Gál Geotechnika Bt.2014-11-18 23:01:04részletek
799potgazdi.huOlma Gabriella2014-11-18 23:01:04részletek
800orange-oil.huDom West Kft2014-11-18 23:01:04részletek
801agoratermeloipiac.huAgora a Termelők Piacáért Egyesület2014-11-18 23:01:04részletek
802hooh.huMayer Norbert2014-11-18 23:01:04részletek
803whiteingatlan.huSmicskó Ágnes e. v.2014-11-18 23:01:04részletek
804m15residence.huM15 Villa Rezidencia Kft.2014-11-18 23:01:03részletek
805arkenstonemainecoon.huNagy Éva2014-11-18 23:01:03részletek
806pulsarium.huKollár István2014-11-18 23:01:03részletek
807woodman.huErdélyi-Woodman Kft.2014-11-18 23:01:03részletek
808top10radio.huElek Imre2014-11-18 23:01:03részletek
809lem2-gyor.huInfoartnet Kft.2014-11-18 23:01:03részletek
810soft-telekom.huSoft-Dekor Kft2014-11-18 23:01:03részletek
811kettlebellakademia.huIllés László2014-11-18 23:01:02részletek
812johirnevklub.huTóth Zoltán2014-11-18 23:01:02részletek
813nagytomi.huNagy Tamás2014-11-18 23:01:02részletek
814szaboestsa.huGyapiNet Bt.2014-11-18 23:01:02részletek
815crystalszepsegszalon.hu6 sz. 2010. Kft.2014-11-18 23:01:01részletek
816radio1gyor.huSzakos Péter2014-11-18 19:01:08részletek
817bringacentrum.huKercom Kft2014-11-18 19:01:07részletek
818bécs.huTóth Éva2014-11-18 19:01:07részletek
819meteospasmyl.huSager Pharma Kft.2014-11-18 19:01:07részletek
820619media.huLückl Roland2014-11-18 19:01:07részletek
821investola.huSteier Márton2014-11-18 19:01:07részletek
822kisugarzas.huKardos Levente2014-11-18 19:01:06részletek
823csakazene.huVarga Sándor E. V.2014-11-18 19:01:06részletek
824b-g.huNémeth Lajos2014-11-18 19:01:06részletek
825egzotikusutazasok.huForró Tamás Attila2014-11-18 19:01:06részletek
826otthoniuzlete.huUngár Ferenc2014-11-18 19:01:06részletek
827wooo.huVIDGET.HU Kft.2014-11-18 19:01:06részletek
828ruhaklinika.huMens Wear Kft.2014-11-18 19:01:05részletek
829creditpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
830virtualbank.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
831webajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
832uzletiajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
833kronikakonyvesbolt.huIntec Online Kft. (Registrar)2014-11-18 19:01:05részletek
834intimtorna-budapest.huIlok-Székely Zsanett2014-11-18 19:01:05részletek
835vinko.huVinkó Zoltán Tamás2014-11-18 19:01:04részletek
836fiataltehetsegekertalapitvany.huFiatal Tehetségekért Alapítvány2014-11-18 19:01:04részletek
837nokapalyan.huPéterfy-Novák Éva2014-11-18 19:01:04részletek
838webpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:04részletek
839osztalypenztar.huUnidomain Kft.2014-11-18 19:01:04részletek
840airacademy.huWebenlét Kft.2014-11-18 19:01:04részletek
841drkissedit.huBánhalmi András2014-11-18 19:01:04részletek
842kacsalla.huHATALA ZSOLT2014-11-18 19:01:03részletek
843yourbenefits.huMustafa Györgyi Gina2014-11-18 19:01:03részletek
844universalmedia.huKnapp Dávid2014-11-18 19:01:03részletek
845borsabrown.huPublish and More Kft.2014-11-18 19:01:03részletek
846wellnesspatextil.huDagdelen Emrah2014-11-18 19:01:03részletek
847madohome.huDagdelen Emrah2014-11-18 19:01:03részletek
848völker.huVölker Tamás2014-11-18 19:01:02részletek
849gardrob.huKiberNet Kft.2014-11-18 19:01:02részletek
850zenmate.huZenGuard GmbH2014-11-18 19:01:02részletek
851mulatosmiki.huHuncsik Ádám2014-11-18 19:01:02részletek
852tuzifagyar.huIwood Kft.2014-11-18 19:01:01részletek
853bigbuy.huBichis János2014-11-18 19:01:01részletek
854bfn.huBloom Fashion Group Kft.2014-11-18 14:01:30részletek
855speedtruckservice.huSpeed Truck Service Kft.2014-11-18 14:01:30részletek
856signalshop.huFerunio 95 Kft.2014-11-18 14:01:30részletek
857classmodell.huFülöpp Péter2014-11-18 14:01:30részletek
858e-dietetikus.huBallai Márta2014-11-18 14:01:30részletek
859csillagokhaboruja.huSimon Zoltán2014-11-18 14:01:30részletek
860aquastic.huWebsupport s.r.o.2014-11-18 14:01:29részletek
861creatiw.huLuremta Ker. Kft.2014-11-18 14:01:29részletek
862ozdfoto.huJancsurák Gábor2014-11-18 14:01:29részletek
863taichi-mindenkinek.huAnonymouse Domains s.r.o.2014-11-18 14:01:29részletek
864goldicon.huOroszi Károly2014-11-18 14:01:29részletek
865classhostess.huFülöpp Péter2014-11-18 14:01:29részletek
866rinity.huSzabó Károly2014-11-18 14:01:29részletek
867karcagi-peter.huCogitate Games Kft.2014-11-18 14:01:29részletek
868csokifalat.huBor Panna2014-11-18 14:01:28részletek
869legterillatositas.huEmpresa Szolgáltató Bt2014-11-18 14:01:28részletek
870qualitytrading.huQuality Trading Bt.2014-11-18 14:01:28részletek
871learmorszakszervezet.huDanka Attila2014-11-18 14:01:28részletek
872borsokaland.huGulyás júlia2014-11-18 14:01:28részletek
873tiszatrade.huTISZA-TRADE KFT2014-11-18 14:01:28részletek
874edesannacukraszdak.huDIAN CAFFE Kft.2014-11-18 14:01:28részletek
875tisztatarsashaz.huSzabó Péter2014-11-18 14:01:28részletek
876laptopszervizszolnok.huADACSA Kft.2014-11-18 14:01:27részletek
877elsomilliom.huPistyur Veronika2014-11-18 14:01:27részletek
878todayslook.huHostnet bv2014-11-18 14:01:27részletek
879mailworx.hueworx Network & Internet GmbH2014-11-18 14:01:27részletek
880redoxcsoport.huEszik Marianna2014-11-18 14:01:27részletek
881hugs.huLenka Baldrianova2014-11-18 14:01:27részletek
882panelprogram2015.huDobonyi Valentina2014-11-18 14:01:27részletek
883csakany-es-penna-kovycs59.huKovács László2014-11-18 14:01:27részletek
884targoncaforum.huHÓD-Agroszer Kft.2014-11-18 14:01:26részletek
885helipest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
886helibudapest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
887budapesthelikopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
888budapesthelicopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
889styleboutique.huBalla Tibor2014-11-18 14:01:26részletek
890fozo-ust.huIstella Tamás2014-11-18 14:01:25részletek
891petrénypincészet.huSzabó Richárd András2014-11-18 14:01:25részletek
892kronikasa.huCsordás Zoltán2014-11-18 14:01:25részletek
893szonyegekonline.huSakina-Textile Kft2014-11-18 14:01:25részletek
894dantian.huFortis Solutio Kft.2014-11-18 14:01:25részletek
895mezohegyesszakkepzeseert.huSzumaszi Bt.2014-11-18 14:01:25részletek
896valmontkontroll.huSzabó József EV.2014-11-18 14:01:25részletek
897hetta.huHepp Brigitta2014-11-18 14:01:24részletek
898ingatlan-ker.huGigaweb Kft2014-11-18 14:01:24részletek
899familiatermekek.huPick Szeged Zrt.2014-11-18 14:01:24részletek
900interplex.co.huInterplex Hungary, Kft.2014-11-18 14:01:24részletek
901sipper.huSipper Transport Kft. 2014-11-18 14:01:24részletek
902bartime.huNehmar Yacine2014-11-18 14:01:24részletek
903gabormiklos.huGábor Katalin2014-11-18 14:01:24részletek
904trinomkft.huTRINOM Kft.2014-11-18 14:01:23részletek
905selfipalca.huVeres Tamás2014-11-18 14:01:23részletek
906szelfipalca.huVeres Tamás2014-11-18 14:01:23részletek
907szelfiebot.huVeres Tamás2014-11-18 14:01:23részletek
908szelfiepalca.huVeres Tamás2014-11-18 14:01:23részletek
909lepkeovigyor.huTárogató Óvoda Lepke Tagóvodája 2014-11-18 14:01:23részletek
910nophone.hueClick Apps Kft.2014-11-18 14:01:23részletek
911franciae-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
912némete-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
913mobilkutyu.huPC Webáruház Kft. 2014-11-18 14:01:22részletek
914buvohelybuda.info.huPécsvári Richárd2014-11-18 14:01:22részletek
915delelopince.huBusiness Innovant Kft.2014-11-18 14:01:22részletek
916etteremlatogato.huSzilléri Kft.2014-11-18 14:01:22részletek
917newfacemarketing.huNagy Gábor2014-11-18 14:01:22részletek
918papirekszer.huMéri Judit2014-11-18 14:01:22részletek
919tibysoft.huMészáros Tibor2014-11-18 14:01:22részletek
920régiségekpiaca.huKérai Gusztáv2014-11-18 14:01:22részletek
921szakmattanulok.huJózanné Sipos Etelka2014-11-18 14:01:21részletek
922építésihibákfolyóirat.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
923építési-hibák.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
924hunyadygabor.huConsult Unio Kft2014-11-18 14:01:21részletek
925adotanacsadoszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
926ugyvedegyesulet.huMagyar Ügyvédek Egyesülete2014-11-18 14:01:21részletek
927depostone.huFarkas Gyula2014-11-18 14:01:21részletek
928munkajogszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
929tuzvedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
930munkavedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
931szamvitelszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
932plastinvest.huKurán Antal2014-11-18 14:01:20részletek
933ugyved-katalogus.huKányási Péter2014-11-18 14:01:20részletek
934icamamahusboltja.huBia-Dia Faloda Kft2014-11-18 14:01:19részletek
935epitesihibakfolyoirat.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
936epitesihibakmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
937epitesihibakszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
938orosze-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
939spanyole-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
940ieskft.huIpari Elektronikai Szervíz Kft.2014-11-18 14:01:18részletek
941yupri.huPreisvergleich.de Berlin AG2014-11-18 14:01:18részletek
942keleticsucsok.huBusiness Innovant Kft.2014-11-18 14:01:18részletek
943építésihibákmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
944hidraulikajaszbereny.huSzele-Főnix Kft.2014-11-18 14:01:18részletek
945selfiepalca.huVeres Tamás2014-11-18 14:01:18részletek
946roachy.huRozsnyai Zsolt2014-11-18 14:01:18részletek
947epitesi-hibak.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
948wineboutiqe.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
949építésihibák.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
950tarpahill.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
951építésihibákszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
952selfibot.huVeres Tamás2014-11-18 14:01:17részletek
953stadionguide.huElender 2000 Kft2014-11-18 14:01:17részletek
954stadionkalauz.huElender 2000 Kft2014-11-18 14:01:17részletek
955beltekcoop.huBéltek Coop Zrt.2014-11-18 14:01:17részletek
956funds4i.huVicze Gabor2014-11-18 14:01:16részletek
957ritanti.huTóthné Herner Rita2014-11-18 14:01:16részletek
958delelőpince.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
959greenvulcano.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
960horfa.huHorváth György2014-11-18 14:01:16részletek
961justnatural.huNagyné Csorba Zsuzsanna2014-11-18 14:01:16részletek
962transzfer-eger.huDONUCS SPEED Bt.2014-11-18 14:01:16részletek
963konyvkoto.huBártfai Balázs2014-11-18 14:01:16részletek
964egeszseges-kulacs.huR&B Medilek spol. s r.o.2014-11-18 14:01:15részletek
965evezzobudan.huGanz Villamossági Evezős Klub 2014-11-18 14:01:15részletek
966toyotacenter.huEmil Frey Magyarország Kft2014-11-18 14:01:15részletek
967chetrin.huCHETRIN Szociális Szövetkezet2014-11-18 14:01:15részletek
968csikotuzhely.huPorgesz Gábor2014-11-18 14:01:15részletek
969kredencjava.huBusiness Innovant Kft.2014-11-18 14:01:15részletek
970geodrone.huGeomentor Kft2014-11-18 14:01:15részletek
971usfsbudapesthomes.huKudelász Balázs2014-11-18 14:01:15részletek
972geszlerkft.huGeszler Kft.2014-11-18 14:01:14részletek
973netvarium.huNetvarium.hu Kft.2014-11-18 14:01:14részletek
974weboldalszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
975honlapszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
976pcszervizszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
977nemalicit.huGelencsér Judit2014-11-18 14:01:14részletek
978toyota-pest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
979toyota-budapest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
980toyotazuglo.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
981xtree.huProfilm DTP Kft.2014-11-18 14:01:13részletek
982buvohelybudaors.huPécsvári Richárd2014-11-18 14:01:13részletek
983alkalmi-buvohelybuda.huPécsvári Richárd2014-11-18 14:01:13részletek
984moderndogfurniture.huVágner Adrienn2014-11-18 14:01:13részletek
985nfm.huSimia Alba Kft.2014-11-18 14:01:13részletek
986toyota-frey.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
987blankart.huSimon Levente2014-11-18 14:01:12részletek
988toyota-szalon.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
989virusirtasszolnok.huADACSA Kft.2014-11-18 14:01:12részletek
990dnscarbon.huVarga Dénes2014-11-18 14:01:12részletek
991mxmphoto.huLovas Gábor2014-11-18 14:01:12részletek
992ultetokartya.huIkeszep Bt.2014-11-18 14:01:12részletek
993bistromandarin.huGBaRT Design Stúdió Kft.2014-11-18 14:01:11részletek
994bbbau.huKovács Attila2014-11-18 14:01:11részletek
995dogfurniture.huVágner Adrienn2014-11-18 14:01:11részletek
996szakmaicegbazis.huMiszlai-Holdosi Henrietta2014-11-18 14:01:11részletek
997design4-u.huMészáros Dóra2014-11-18 14:01:11részletek
998takacszsolt.huTakács Zsolt EV2014-11-18 14:01:11részletek
999bitsector.huWebon Consulting Kft.2014-11-18 14:01:11részletek
1000szemelyesatvetelipont.huManda Kft.2014-11-18 14:01:11részletek
1001budapestfashionnight.huBloom Fashion Group Kft.2014-11-18 14:01:10részletek
1002modernkutyabutor.huVágner Adrienn2014-11-18 14:01:10részletek
1003chatvonal.huConPhone Audio Conferening Kft.2014-11-18 14:01:10részletek
1004dovre.huWebsupport s.r.o.2014-11-18 14:01:10részletek
1005uzletekpapa.huStone-Press Bt.2014-11-18 14:01:10részletek
1006bestdivingplaces.huKrix Zoltánné2014-11-18 14:01:10részletek
1007pecsiingatlan.huRackhost Kft. (Registrar)2014-11-18 14:01:10részletek
1008ricamente.huRicamente Kft.2014-11-18 14:01:09részletek
1009allatbutor.huVágner Adrienn2014-11-18 14:01:09részletek
1010ingatlan-balaton.huKovács Attila2014-11-18 14:01:09részletek
1011rendszergazdaszolnok.huADACSA Kft.2014-11-18 14:01:09részletek
1012spineartgyogytorna.huHolcsa Judit2014-11-18 14:01:09részletek
1013masszorguru.huNothnágel Balázs2014-11-18 14:01:09részletek
1014cekka.huHorváthné Kiss Claudia EV2014-11-18 14:01:09részletek
1015vendeglatoingatlanok.huHiker 2000 Bt.2014-11-18 14:01:08részletek
1016soszoba-sopron.huKerékgyártó Kereskedelmi és Szolg. Bt.2014-11-18 14:01:08részletek
1017eletital.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
1018johnnybudapest.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
1019merlinszalon.huWorld-System kft.2014-11-18 14:01:08részletek
1020fotosvagyok.huRozsnyai Zsolt2014-11-18 14:01:08részletek
1021aaaa.huGéczi János2014-11-18 14:01:08részletek
1022olasze-egyetem.huKósz Csaba2014-11-18 14:01:08részletek
1023dixdox.huDigital Packaging and Promotion Kft.2014-11-18 14:01:07részletek
1024vv9.huKókai László2014-11-18 14:01:07részletek
1025szocstamas.huDr. Szőcs Tamás2014-11-18 14:01:07részletek
1026attilavill.huATTILAVILL Kft.2014-11-18 14:01:07részletek
1027horvateskuvo.huSzabó László2014-11-18 14:01:07részletek
1028nativaszappan.huSchall Tamás2014-11-18 14:01:07részletek
1029trofeaebed.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:07részletek
1030jogaswing.huZYD-Szer Kft.2014-11-18 14:01:06részletek
1031tavaszizene.huTatabányART Művészeti Egyesület2014-11-18 14:01:06részletek
1032keleticsücsök.huBusiness Innovant Kft.2014-11-18 14:01:06részletek
1033scoliosisterapia.huHolcsa Judit2014-11-18 14:01:06részletek
1034softwarecraftsmanship.huAndó Művek Korlátolt Felelősségű Társaság2014-11-18 14:01:06részletek
1035trófeaebéd.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:06részletek
1036farmrtk.huFöldmérési és Távérzékelési Intézet2014-11-18 14:01:05részletek
1037ds-drive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
1038dsdrive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
1039morelhifi.huPapp Zsolt2014-11-18 14:01:05részletek
1040budapestkutyakozmetika.huWinkler Judit2014-11-18 14:01:05részletek
10411domain.huBártfai Balázs2014-11-18 14:01:05részletek
1042bekesijarasok.huMCOnet International Kft.2014-11-18 14:01:04részletek
1043papinothpekseg.huPapinoth Sütőipari Kft2014-11-18 14:01:04részletek
1044oazisstreaming.huOÁZIS Kkt.2014-11-18 14:01:04részletek
1045skyflytravel.huZ+T Bt.2014-11-18 14:01:04részletek
1046jannus.huCsillag Kiadó Kft.2014-11-18 14:01:04részletek
1047agostonalapitvany.huÁgoston Sándor Alapítvány2014-11-18 14:01:04részletek
1048anyalelek.huDénes Margit2014-11-18 14:01:03részletek
1049karmablog.huTarnai Akos2014-11-18 14:01:03részletek
1050pillanatom.huSzabó Gábor2014-11-18 14:01:03részletek
1051vanillaworks.huJózsef Adrienn2014-11-18 14:01:03részletek
1052bestclean.huHussein Zoltán2014-11-18 14:01:03részletek
1053tnno.huAdminSYS Kft.2014-11-18 14:01:03részletek
1054forintfitnesz.huHuszthy Gergely Balázs2014-11-18 14:01:03részletek
1055providss.huProvid Special Service Kft.2014-11-18 14:01:02részletek
1056lxy.huDömötör Tímea Zsuzsanna2014-11-18 14:01:02részletek
1057oftn.huOrszágos Fejlesztési Tanácsadó Nonprofit Kft.2014-11-18 14:01:02részletek
1058mylan.co.huEuromarknet Kft. (Registrar)2014-11-18 14:01:02részletek
1059xes.huMolnár Enikő2014-11-18 14:01:02részletek
1060reszletre.huBártfai Balázs2014-11-18 14:01:02részletek
1061ugyveditudastar.huMenedzser Praxis Kft.2014-11-18 14:01:02részletek
1062biotea.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
1063englishteashop.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
1064dronewebshop.huBóna Dániel2014-11-18 14:01:01részletek
1065átvételi-pont.huManda Kft.2014-11-18 14:01:01részletek
1066amitarsashazunk.huLivingstones Hungary Kft.2014-11-17 23:01:02részletek
1067kekpiramis.huTechcentral Kft.2014-11-17 23:01:02részletek
1068kertalkotok.huMándoky Petra Dorottya 2014-11-17 23:01:02részletek
1069passionerie.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
1070jobtogo.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
1071kiwisuncosmetics.huHI-RE Kft2014-11-17 23:01:01részletek
1072b-intense.huB-intense GmbH Als Zweigniederlassung Der CB-Capital GmbH2014-11-17 23:01:01részletek
1073brandandtrend.hu CIPŐGURU KFT.2014-11-17 23:01:01részletek
1074protokoll-beszerzes.huMajor Roland2014-11-17 23:01:01részletek
1075kornyezettudatos.huKump Edina2014-11-17 19:01:23részletek
1076kilincsdesign.huB&M Mechanika Kft.2014-11-17 19:01:22részletek
1077megoldasmediacio.huVégh János2014-11-17 19:01:22részletek
1078online-kotes.huKecskés Zsolt2014-11-17 19:01:22részletek
1079sutimegen.huWebsupport s.r.o.2014-11-17 19:01:22részletek
1080viaferrata-rax.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:22részletek
1081drdata.huVárkonyi Attila2014-11-17 19:01:22részletek
1082epitoanyagportal.huKirály Zsolt2014-11-17 19:01:22részletek
1083ajandeknyomda.huGurmai Sándor 2014-11-17 19:01:22részletek
1084villanymargareta.huPászti János2014-11-17 19:01:22részletek
1085korosietterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:21részletek
1086mokajenne.huAzonnal Kft.2014-11-17 19:01:21részletek
1087lekocsma.huMuzslay Tamás2014-11-17 19:01:21részletek
1088kacagokacat.huEncziné Varga Andrea2014-11-17 19:01:21részletek
1089legyelegeszseges.huKrizsán Tamás2014-11-17 19:01:21részletek
1090tcg-global.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:21részletek
1091calibrapet.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:21részletek
109267p.huPohl Veronika2014-11-17 19:01:20részletek
1093skypeprofesszor.huSztolár Miklós2014-11-17 19:01:20részletek
1094viaferrata-garda-to.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:20részletek
1095szemelyiedzok.huBatyi Béla2014-11-17 19:01:20részletek
1096erdosdenes.huErdős Dénes2014-11-17 19:01:20részletek
1097tomitextil.huMaszlag Tamás2014-11-17 19:01:20részletek
1098beanlight.hu Discovery Bliss Kft.2014-11-17 19:01:20részletek
1099tapetafutar.huÁrvai Sándor2014-11-17 19:01:19részletek
1100uttern.huGrassland Kft2014-11-17 19:01:19részletek
1101gyerekjátékshop.huHajnal Zsombor EV2014-11-17 19:01:19részletek
1102calibratap.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:19részletek
1103designmadeinhungary.huSimon Péter2014-11-17 19:01:19részletek
1104tothgabriella.huTóth Gabriella2014-11-17 19:01:19részletek
1105gather.huEcsedi Ádám2014-11-17 19:01:19részletek
1106autoszervizpenztargep.huNazza Software Kft.2014-11-17 19:01:19részletek
1107nyirvillany.huPátrovics Milán2014-11-17 19:01:18részletek
1108festekwebbolt.huPoli-Farbe Kft.2014-11-17 19:01:18részletek
1109nemetiskola.huBambuk László2014-11-17 19:01:18részletek
1110rentallcar.huPálvölgyi Gábor2014-11-17 19:01:18részletek
1111nlksz.huWhitehall's Kft2014-11-17 19:01:18részletek
1112symbolonintezet.huQS 2000 Bt.2014-11-17 19:01:18részletek
1113zoldero.huRuffnet Zrt.2014-11-17 19:01:18részletek
1114novalja.huVinko Róbert2014-11-17 19:01:17részletek
1115sajticsaba.huSajti Csaba2014-11-17 19:01:17részletek
1116masterbaits.huVeres Tamás E.v.2014-11-17 19:01:17részletek
1117independencekey.huKocsis Tamás2014-11-17 19:01:17részletek
1118f-h.huISD DUNAFERR Zrt.2014-11-17 19:01:17részletek
1119kozmetikuspenztargepek.huNazza Software Kft.2014-11-17 19:01:17részletek
1120dietrend.huYes-Média Kft.2014-11-17 19:01:17részletek
1121munkavedelembiztonsag.huSeres Gyorgy2014-11-17 19:01:17részletek
1122gyemantmezo.huNetworking Kelet-Magyarország Kft.2014-11-17 19:01:16részletek
1123topapartman.huBluecast Kft. (Registrar)2014-11-17 19:01:16részletek
1124tapetanagyker.huKutasi-Vilsitz Kft2014-11-17 19:01:16részletek
1125dynamitebaits.huHalász László2014-11-17 19:01:16részletek
1126honlaptervezok.huD-Com Group Kft2014-11-17 19:01:16részletek
1127kiskom.huKis Norbert2014-11-17 19:01:16részletek
1128londonetterem.huTóth Attila2014-11-17 19:01:16részletek
1129keleterintese.huSzőke Attila2014-11-17 19:01:16részletek
1130dugulaselharitas.lakas.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
1131dugulaselharitas.video.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
1132hirekelsokezbol.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1133sajtosport.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1134swaszervizkft.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1135tcgglobal.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:15részletek
1136bfb.co.huB.F.B. CONSULTING Kft.2014-11-17 19:01:15részletek
1137kislan.huKis Norbert2014-11-17 19:01:15részletek
1138infoksport.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1139hirekazorszagbol.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1140aktivsportok.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1141hobbikezilabda.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1142partytrendek.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1143okosvercukormero.huPromedtron Kft.2014-11-17 19:01:14részletek
1144okosmerleg.huPromedtron Kft.2014-11-17 19:01:14részletek
1145kotai.huUnidomain Kft.2014-11-17 19:01:14részletek
1146ecoheat.huSzél Zoltán2014-11-17 19:01:14részletek
1147okosvernyomasmero.huPromedtron Kft.2014-11-17 19:01:13részletek
1148alefgaszt.huAlefgaszt Kft.2014-11-17 19:01:13részletek
11492juhasz.huJuhász Tamás2014-11-17 19:01:13részletek
1150ipole.huUdvardy Sára2014-11-17 19:01:13részletek
1151milasslim.huMilassin András2014-11-17 19:01:13részletek
1152paleopontpecs.huPabelo Kft.2014-11-17 19:01:13részletek
1153fodraszpenztargepek.huNazza Software Kft.2014-11-17 19:01:13részletek
1154lagunahome.huP.R. Fürdőszoba Kft.2014-11-17 19:01:12részletek
1155swconsulting.huST devices Bt.2014-11-17 19:01:12részletek
1156ededesign.huPojtli Gábor E.V.2014-11-17 19:01:12részletek
1157termeloimezpiac.huMakács Zoltán2014-11-17 19:01:12részletek
1158dugulaselharitas.2000.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:12részletek
1159delkim.huHalász László2014-11-17 19:01:12részletek
1160goncbolha.huPC-Fenomén Kft.2014-11-17 19:01:12részletek
1161gourmetboutique.huGRAPIXX HOSTING KFT.2014-11-17 19:01:12részletek
1162maszotars.huTájnel Gábor2014-11-17 19:01:11részletek
1163dugulaselharitas.ingatlan.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
1164dugulaselharitas.org.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
1165munkaruhanet.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1166onenesscoffee.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1167goazis.huVajda Péter2014-11-17 19:01:11részletek
1168szulinapra2010.huTarján Tibor2014-11-17 19:01:11részletek
1169vabrikpaintball.huVabrik és Fia Kft2014-11-17 19:01:10részletek
1170elektrovillbau.huEVB Építő Kft.2014-11-17 19:01:10részletek
1171viaferrata-dolomitok.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:10részletek
1172szakalyjanos.huSzakály János2014-11-17 19:01:10részletek
1173raspartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1174ringieraxelspringerpartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1175csmix.huEcsedi Ádám2014-11-17 19:01:10részletek
1176faeka.huHenkel Magyarország Kft2014-11-17 19:01:09részletek
1177robotest.huRobotguru Kereskedőház Kft.2014-11-17 19:01:09részletek
1178elitetetofedes.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
1179eliteitsys.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
1180szolnoketterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:09részletek
1181alizium.huNagy-Kollár Alíz2014-11-17 19:01:09részletek
1182cuponation.huPiquerez Nicolas2014-11-17 19:01:09részletek
1183anikodxn.huFaragó Anikó2014-11-17 19:01:09részletek
1184helpme.huNetworKing Informatika Kft.2014-11-17 19:01:09részletek
1185roboroom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1186robozoom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1187philae.huPohl Veronika2014-11-17 19:01:08részletek
1188lifemaster.huMravik Zsolt2014-11-17 19:01:08részletek
1189erdelyimagyarokkozossege.huWebsupport s.r.o.2014-11-17 19:01:08részletek
1190dreamday.huKender Anita2014-11-17 19:01:08részletek
1191sweethairwebshop.huHorváth Bíborka2014-11-17 19:01:08részletek
1192roboshop.huRobotguru Kereskedőház Kft.2014-11-17 19:01:07részletek
1193museumhotel.huNext Kft.2014-11-17 19:01:07részletek
1194bacska-online.huKecskés Zsolt2014-11-17 19:01:07részletek
1195intellicon.huOrosz Péter2014-11-17 19:01:07részletek
1196medihol.huSzilágyi Informatika és Műszertechnika Kft.2014-11-17 19:01:07részletek
1197korall-zazo.huZAZO Innovációs Holding Kft2014-11-17 19:01:07részletek
1198mindenfoci.huSWA Szervíz Kft2014-11-17 19:01:07részletek
1199regisegekpiaca.huKérai Gusztáv2014-11-17 19:01:06részletek
1200gyogylaser.huBálint Imre2014-11-17 19:01:06részletek
1201sodrasszalon.hu2GP Kft2014-11-17 19:01:06részletek
1202robotv.huRobotguru Kereskedőház Kft.2014-11-17 19:01:06részletek
1203syncovery.huVE-Matéria Kft.2014-11-17 19:01:06részletek
1204mentortext.huJanó Zoltán2014-11-17 19:01:06részletek
1205biztonsagmuhely.huBiztonság Műhely Szolgáltató Szociális Szövetkezet2014-11-17 19:01:06részletek
1206balaton-tv.huVeresegyházi Városi Televízió Kft.2014-11-17 19:01:05részletek
1207alufeny.huB&M Mechanika Kft.2014-11-17 19:01:05részletek
1208do-re-mi.huMíves Kft.2014-11-17 19:01:05részletek
1209giftshopping.huWebsupport s.r.o.2014-11-17 19:01:05részletek
1210atrainer.huTóth Alexandra2014-11-17 19:01:05részletek
1211mvakolat.huMihucz Miklós e.v.2014-11-17 19:01:05részletek
1212profitisztitas.huUnidomain Kft.2014-11-17 19:01:05részletek
1213ulogarnitura-albadivani.huHorizonet Kft. 2014-11-17 19:01:04részletek
1214defibrillatorplusz.huVarga Erika2014-11-17 19:01:04részletek
1215dkl-org.huDKL Műszaki Organizációs Kft.2014-11-17 19:01:04részletek
1216halkalauz.huJónap Richárd2014-11-17 19:01:04részletek
1217ajto-kilincs.huB&M Mechanika Kft.2014-11-17 19:01:04részletek
1218perfectmind.huDemény Zsolt2014-11-17 19:01:04részletek
1219acrysoftrestor.huMarkMonitor International Ltd.2014-11-17 19:01:04részletek
1220pecsert.huÖsszefogás Pécsért Egyesület2014-11-17 19:01:03részletek
1221profitnavigator.huDiamond Books Kft.2014-11-17 19:01:03részletek
1222zegmechatronika.huPannon Fejlesztési Alapítvány2014-11-17 19:01:03részletek
1223rendezvenyguru.huMillennium International Kft.2014-11-17 19:01:03részletek
1224defibrillatorplus.huVarga Erika2014-11-17 19:01:03részletek
1225cszsgt.huBársony László2014-11-17 19:01:03részletek
1226packersvideotar.huSchmidtka László2014-11-17 19:01:03részletek
1227onlinemarketingtervezes.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1228militariatrend.huRoth Tamás2014-11-17 19:01:02részletek
1229dotindot.huFerenczi Gábor2014-11-17 19:01:02részletek
1230marketingido.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1231veganelet.huBiztos Holnap szociális szövetkezet2014-11-17 19:01:02részletek
1232maganraktar.huBlinszki László2014-11-17 19:01:02részletek
1233agyhatalom.huTúri Lajos2014-11-17 19:01:02részletek
1234fémdetektor.huDETECT MAX HUNGARY Kft.2014-11-17 19:01:02részletek
1235belsoepiteszstudio.huIDM Group Kft. 2014-11-17 19:01:01részletek
1236plazainformacio.huInternet Strategy International Kft.2014-11-17 19:01:01részletek
1237ingatlanconsulting.huNRG-TECH GLOBAL Kft.2014-11-17 19:01:01részletek
1238ezsport.huSWA Szervíz Kft2014-11-17 19:01:01részletek
1239artandcraft.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:25részletek
1240tiensszombathely.huTakács László2014-11-17 14:01:25részletek
1241nyugdijhelyett.huErdős Nóra2014-11-17 14:01:24részletek
1242skydoorshop.huHorváth Roland László E.V.2014-11-17 14:01:24részletek
1243amegoldas.konyvelo.huA MEGOLDÁS Könyvelő Kft.2014-11-17 14:01:24részletek
1244gdse.huLukács Gábor2014-11-17 14:01:24részletek
1245zemplenkincsei.huZemplén Kincsei Szociális Szövetkezet2014-11-17 14:01:24részletek
1246prc-product.huKovács András2014-11-17 14:01:24részletek
1247stilusesdivat.huRiczkó István2014-11-17 14:01:24részletek
1248bonzo.huEuroCable Magyarorszag Kft.2014-11-17 14:01:24részletek
1249vasscsalad.huVass Bence2014-11-17 14:01:23részletek
1250vanilia123.huLászló Éva2014-11-17 14:01:23részletek
1251iexpress.huRocskar Tibor2014-11-17 14:01:23részletek
1252highfashion.huEuroDNS S.A.2014-11-17 14:01:23részletek
1253bububababolt.hu Kígyós Ferenc2014-11-17 14:01:23részletek
1254tamaratorna.huST Art & Web Kft.2014-11-17 14:01:23részletek
1255adventbécs.huTóth Éva2014-11-17 14:01:23részletek
1256korall-szepsegszalon.huVarga- Kovács Nikolett2014-11-17 14:01:23részletek
1257mrspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1258misterspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1259moloetterem.huEuroDNS S.A.2014-11-17 14:01:22részletek
1260rockmunkavedelem.huMolnár és Társa Kft.2014-11-17 14:01:22részletek
1261nemettanfolyam.huSzigeti Ágnes2014-11-17 14:01:22részletek
1262okoskutyuk.huGradinops Kft.2014-11-17 14:01:22részletek
1263elelemetterem.huÉl-Elem Étterem Kft.2014-11-17 14:01:22részletek
1264nagy-ep.huNagy Gábor2014-11-17 14:01:22részletek
1265kosem.huTrivium Kiadó Kft.2014-11-17 14:01:21részletek
1266napraforgo-kineziologia.huPRST-Invest Kft.2014-11-17 14:01:21részletek
1267eletvezetesitanacsadas.huDr. Asztalos Attila2014-11-17 14:01:21részletek
1268eletvezetesitanacsado.huDr. Asztalos Attila2014-11-17 14:01:21részletek
1269asztalosattila.huDr. Asztalos Attila2014-11-17 14:01:21részletek
1270rocksafety.huMolnár és Társa Kft.2014-11-17 14:01:21részletek
1271masvagyok.huPapp Zsolt2014-11-17 14:01:21részletek
1272csempe-furdoszoba.huVarga Tamás2014-11-17 14:01:21részletek
1273globalsummit.huBalogh Sándor2014-11-17 14:01:20részletek
1274disz.huWebsupport s.r.o.2014-11-17 14:01:20részletek
1275jucuskonyhája.huFleischmann Pál2014-11-17 14:01:20részletek
1276trenditv.huEuroCable Magyarorszag Kft.2014-11-17 14:01:20részletek
1277bedcinema.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
1278agymozi.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
1279tizenketto.huKő Tamás2014-11-17 14:01:20részletek
1280orvospenztargepek.huNazza Software Kft.2014-11-17 14:01:19részletek
1281motiválódok.huGyeszát Zsolt2014-11-17 14:01:19részletek
1282szamitogep-laptopszerviz.huP-norton Kft.2014-11-17 14:01:19részletek
1283parokaplaza.huWeb-Zseb Kereskedelmi és Szolgáltató Bt.2014-11-17 14:01:19részletek
1284talizmansport.huPapp Jánosné2014-11-17 14:01:19részletek
1285xrosecrystal.huDáné Alexandra2014-11-17 14:01:19részletek
1286ityuk.huWebsupport s.r.o.2014-11-17 14:01:19részletek
1287shoppingvin.huDolphinet Kft.2014-11-17 14:01:18részletek
1288legyelbator.huErdős Nóra2014-11-17 14:01:18részletek
1289budapestwiengid.huHorváth Dóra2014-11-17 14:01:18részletek
1290primusaqua.huBonaventura Gold Kft2014-11-17 14:01:18részletek
1291nemetautodiszkont.huNémet Autódiszkont Kft.2014-11-17 14:01:18részletek
1292teaacademy.hu Sólámpás Kft.2014-11-17 14:01:18részletek
1293kgstpiac.huKaczur Tibor2014-11-17 14:01:18részletek
1294opelbarta.huAutó Bartex Kft.2014-11-17 14:01:18részletek
1295szulejmán.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1296hürrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1297dominovendeghaz.huEuroDNS S.A.2014-11-17 14:01:17részletek
1298hurrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1299kösem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1300szallodaknapja.huEuroDNS S.A.2014-11-17 14:01:17részletek
1301ntlaw.huEyegager Szolgáltató és Tanácsadó Korlátolt Felelősségű Társaság2014-11-17 14:01:17részletek
1302kaszanyidora.huKaszanyi Dóra2014-11-17 14:01:16részletek
1303napifrissites.hu Taktikon Kft.2014-11-17 14:01:16részletek
1304autoplusz.huEuroDNS S.A.2014-11-17 14:01:16részletek
1305bujinkanbudapest.huEuroDNS S.A.2014-11-17 14:01:16részletek
1306colorpor.huEuroDNS S.A.2014-11-17 14:01:16részletek
1307barbara.co.huMark Marketing Kft.2014-11-17 14:01:16részletek
1308myrun.huWalter Ulrik2014-11-17 14:01:16részletek
1309everydaybudapest.huMudra László2014-11-17 14:01:15részletek
13101861pecs.huUpsolution Kft.2014-11-17 14:01:15részletek
1311superworld.hu Dora-Land Kft.2014-11-17 14:01:15részletek
1312eurokartevoirtas.huDomoszlai Dávid2014-11-17 14:01:15részletek
1313owhungary.huSk-Bau Kft.2014-11-17 14:01:15részletek
1314online-uzlet.huGila Ádám2014-11-17 14:01:15részletek
13153d-fal.huGila Ádám2014-11-17 14:01:15részletek
1316saturdays.huKovács Balázs2014-11-17 14:01:14részletek
1317navithere.huVilágom Közepén Kft.2014-11-17 14:01:14részletek
1318uresbeszed.huErdős Nóra2014-11-17 14:01:14részletek
1319mysticmoment.huSzabó Ákos2014-11-17 14:01:14részletek
1320feketehegyingatlan.huSzáler Gábor2014-11-17 14:01:14részletek
1321kispince.huKis Csaba2014-11-17 14:01:14részletek
1322valiszepseg.huSzoboszlay András2014-11-17 14:01:14részletek
1323weddingonline.huKovács Ádám e.v. 2014-11-17 14:01:14részletek
1324orszagospenztargepszovetseg.huNazza Software Kft.2014-11-17 14:01:13részletek
1325chop.huKovács Balázs2014-11-17 14:01:13részletek
13263mango.huTóth Attila2014-11-17 14:01:13részletek
1327korsal.huSütő-Nagy Borbála2014-11-17 14:01:13részletek
1328kockatomb.huNagy Tibor2014-11-17 14:01:13részletek
1329fdmtrade.huFDM TRADE Kft.2014-11-17 14:01:13részletek
1330csabapolo.huCsabai Csirkefogók Vizilabda Klub2014-11-17 14:01:13részletek
1331doorandglassdesign.huHorváth Gábor 2014-11-17 14:01:13részletek
1332navi-there.huVilágom Közepén Kft.2014-11-17 14:01:12részletek
1333hair4u.huHD Group Kommunikacios Ugynokseg Kft.2014-11-17 14:01:12részletek
1334budapestickets.huTktStaff Kft.2014-11-17 14:01:12részletek
1335mozivan.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1336tvcool.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1337eljegyzesigyuruk.huVér József2014-11-17 14:01:12részletek
1338taplalkozastudomany.huPankotai-Nagy Nóra Lívia2014-11-17 14:01:12részletek
1339pepemano.huBaracsi István2014-11-17 14:01:11részletek
1340chilitec.huArtSoft Hungary Kft.2014-11-17 14:01:11részletek
1341balatontickets.huTktStaff Kft.2014-11-17 14:01:11részletek
1342doorandglass.huHorváth Gábor2014-11-17 14:01:11részletek
1343shoppingwin.huDolphinet Kft.2014-11-17 14:01:11részletek
1344szepnapok.huErdős Nóra2014-11-17 14:01:11részletek
1345varoslodiovoda.huHegyi Attila2014-11-17 14:01:11részletek
1346revelar.huNaturemed Kft2014-11-17 14:01:10részletek
1347grandechico.hu Berger Gasztro Kft.2014-11-17 14:01:10részletek
1348techcentral.huTechcentral Kft.2014-11-17 14:01:10részletek
1349bocskaigimnazium.hu Bocskai István Alapitvány2014-11-17 14:01:10részletek
1350icomplete.huWhite Fluffy Cloud Limited2014-11-17 14:01:10részletek
1351srff.huPortoLogic Kft2014-11-17 14:01:10részletek
1352fellepo.huMihalik Béla Csaba2014-11-17 14:01:10részletek
1353chezdodo.huMacaron és társai Kft.2014-11-17 14:01:09részletek
1354ingatlanmobil.huDr Várhegyi Ügyvédi Iroda2014-11-17 14:01:09részletek
1355nsconsulting.hu Next Steps Consulting Kft.2014-11-17 14:01:09részletek
1356valentinra.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
1357ajandekba.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
1358aru24.huHencz Imre e.v.2014-11-17 14:01:09részletek
1359roadruner.huAlcuin Schola Kft.2014-11-17 14:01:09részletek
1360nyákáruház.huHuszár Ádám2014-11-17 14:01:08részletek
1361korruptkormany.huLeft-Wing Network Ltd2014-11-17 14:01:08részletek
1362demir.huBakóczy Zoltán2014-11-17 14:01:08részletek
1363belkinsupport.huFarago Sandor2014-11-17 14:01:08részletek
1364pizzasprintmiskolc.huBrógli Máté2014-11-17 14:01:08részletek
1365drtouchscreen.huKrausz Tamás2014-11-17 14:01:08részletek
1366vilagitaskorszerusites.huE.ON Energiakereskedelmi Kft.2014-11-17 14:01:07részletek
1367spinnerszek.huSpinner Kerekesszék Gyártó Kft.2014-11-17 14:01:07részletek
1368hajdusagisorstarsak.huHajdúsági Sorstársak Együtt Egymásért Egyesülete2014-11-17 14:01:07részletek
1369harkany.hotel.huPaqart design Kft.2014-11-17 14:01:07részletek
1370muller-licht.huSysco-Lux Kft.2014-11-17 14:01:06részletek
1371mysticprod.huMystic Production Kft2014-11-17 14:01:06részletek
1372folyamituzoltosag.huZotmund Pál2014-11-17 14:01:06részletek
1373bsbnetwork.huBalogh Sándor2014-11-17 14:01:06részletek
1374gondozohaz.huUnidomain Kft.2014-11-17 14:01:06részletek
1375redonyerd.huRutai Sándor2014-11-17 14:01:06részletek
1376mueller-licht.huSysco-Lux Kft.2014-11-17 14:01:05részletek
1377tallinton.huLPP S.A.2014-11-17 14:01:05részletek
1378tallinder.huLPP S.A.2014-11-17 14:01:05részletek
1379stoneenergykft.huStone Energy Kft2014-11-17 14:01:05részletek
1380cpptrade.hu Leidgeb Dániel2014-11-17 14:01:05részletek
1381p3t1.huVarga Péter2014-11-17 14:01:05részletek
1382mudi-suli.huBalázs Zsófia2014-11-17 14:01:05részletek
1383romerautosules.huBaba-Ker Kft2014-11-17 14:01:04részletek
1384frima.huKombi Plusz Kft2014-11-17 14:01:04részletek
1385berczy.huBérczy Gergely2014-11-17 14:01:04részletek
1386attractivcenter.huEuroDNS S.A.2014-11-17 14:01:04részletek
1387szatyika.huSzathmári József2014-11-17 14:01:04részletek
1388azeskuvonk.huBalajti István2014-11-17 14:01:04részletek
1389legyelboldog.huErdős Nóra2014-11-17 14:01:03részletek
1390londoniszallas.huSilicium Network Kft. (Registrar)2014-11-17 14:01:03részletek
1391webkepzes.huBalla Ádám2014-11-17 14:01:03részletek
1392szeretetpiac.huRadnay Péter2014-11-17 14:01:03részletek
1393ajandekoznijo.huPárta Péter2014-11-17 14:01:03részletek
1394regenexa.huDr. Bábel Béla Tamás2014-11-17 14:01:03részletek
1395iberianfoods.huEuroDNS S.A.2014-11-17 14:01:02részletek
1396csillagda.huKrix Zoltánné2014-11-17 14:01:02részletek
1397szakikereso.huFilep Józsefné2014-11-17 14:01:02részletek
1398nahungary.huTóth Gábor2014-11-17 14:01:02részletek
1399bionikusalapitvany.huSzűcs László2014-11-17 14:01:02részletek
1400hasznalt-fenymasolok.huProfil-Copy 2002 Kft.2014-11-17 14:01:02részletek
1401okosnyomda.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:01részletek
1402rfb.huUnidomain Kft.2014-11-17 14:01:01részletek
1403borwebaruhaz.huNet-Tech Consulting Kft.2014-11-17 14:01:01részletek
1404magyarfotokabin.huVarga Toth Maria2014-11-17 14:01:01részletek
1405sxi.sport.huPreisinger Gábor2014-11-16 19:01:07részletek
1406pgpro.huWebsupport s.r.o.2014-11-16 19:01:07részletek
1407akkuhazhoz.huFöldesi Zsolt2014-11-16 19:01:07részletek
1408taxismart.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
1409borealattispenzvan.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
1410brickleberry.huNoname Domain Kft.2014-11-16 19:01:06részletek
1411dentsanaheviz.huVass Gyula Istvan2014-11-16 19:01:06részletek
1412sutizz.huSomlyódy-Gerő Eszter2014-11-16 19:01:06részletek
1413kreateve.huRöhricht Szabolcs2014-11-16 19:01:06részletek
1414coolmovie.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
1415moziegy.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
1416wizardkartya.huSuba Gergely2014-11-16 19:01:05részletek
1417gtconsulting.huGergály Tamás2014-11-16 19:01:05részletek
1418valentinre.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1419tabletnyomda.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1420sunrisehosting.huBuzás Péter2014-11-16 19:01:05részletek
1421aerosus.huEuro-Trans Hungary Kft.2014-11-16 19:01:05részletek
1422moviecool.huEuroCable Magyarorszag Kft.2014-11-16 19:01:04részletek
1423pgprof.huWebsupport s.r.o.2014-11-16 19:01:04részletek
1424epitesitabla.huWebenlét Kft.2014-11-16 19:01:04részletek
1425db-system.huWebenlét Kft.2014-11-16 19:01:04részletek
1426animaljam.co.huWebenlét Kft.2014-11-16 19:01:04részletek
1427animaljam.huWebenlét Kft.2014-11-16 19:01:04részletek
1428wonder-cool.huBrill Life Média Kft.2014-11-16 19:01:04részletek
1429movie-one.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1430movie-1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1431movieone.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1432lindtshop.huDomain Robot Limited2014-11-16 19:01:03részletek
1433onniconsulting.huVértes Róbert2014-11-16 19:01:03részletek
1434bencecoach.huNoname Domain Kft.2014-11-16 19:01:03részletek
1435demeterkis.huDemeter Róbert2014-11-16 19:01:03részletek
1436silux.huWebenlét Kft.2014-11-16 19:01:03részletek
1437gyonimajor.huZlinszky Ferenc2014-11-16 19:01:02részletek
1438movie1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1439lindt-shop.huDomain Robot Limited2014-11-16 19:01:02részletek
1440mrbitcoin.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1441optimumhotels.huKlemm Balázs Lajos2014-11-16 19:01:01részletek
1442truehosting.huBakos Attila2014-11-15 14:01:04részletek
1443szakmaktalalkozoja.huEVADO Kft.2014-11-15 14:01:03részletek
1444klacix.huKatona László2014-11-15 14:01:03részletek
1445hpica.huEcologinform Kft.2014-11-15 14:01:03részletek
1446swimmingerd.huÉrdi Úszó Sport Kft2014-11-15 14:01:03részletek
1447dohanyellato.huKovács Péter2014-11-15 14:01:03részletek
1448mariannkavei.huDrinkálné Papp Mariann2014-11-15 14:01:03részletek
1449alphaharmony.huGaál Béla2014-11-15 14:01:03részletek
1450evakonyvek.huSalyámosy Gáborné2014-11-15 14:01:03részletek
1451incipio.co.huEuromarknet Kft. (Registrar)2014-11-15 14:01:02részletek
1452kendereskert.huTóth Imre2014-11-15 14:01:02részletek
1453bimmermaster.huLovas Gergely2014-11-15 14:01:02részletek
1454zsebmania.huEVADO Kft.2014-11-15 14:01:02részletek
1455plat.huNádasdy András2014-11-15 14:01:02részletek
1456orsihaj.huMárkus Ágnes2014-11-15 14:01:02részletek
1457kekmadarovi.huPiroch Ágnes2014-11-15 14:01:02részletek
1458netika.huDr. Lázár Szabolcs2014-11-15 14:01:01részletek
1459szaszabutiq.huPataki Szandra Mária2014-11-14 23:01:03részletek
1460lathatatlantrening.huDarmó Magdolna2014-11-14 23:01:02részletek
1461signbudapest.huKovács Tibor2014-11-14 23:01:02részletek
1462jelszavaim.huSzentrgyörgyi János2014-11-14 23:01:02részletek
1463patkopresszo.huCsilla és István Kft.2014-11-14 23:01:02részletek
1464altsoft.huAltSoft Biztonságtechnikai Kereskedelmi és Szolgáltató Kft.2014-11-14 23:01:02részletek
1465lathatatlantreningek.huDarmó Magdolna2014-11-14 23:01:01részletek
1466gombasautosiskola.huGombás Béla2014-11-14 19:01:38részletek
1467zalkahe.huZAL-KAH Horgászegyesület Kecskemét 2014-11-14 19:01:37részletek
1468beszerez.huARANY KARBON Kft.2014-11-14 19:01:37részletek
1469szeniorapartmanhaz.huKereszthegyi Patrick2014-11-14 19:01:37részletek
1470tachoboss.huF-RONIT Mérnöki Iroda Bt.2014-11-14 19:01:37részletek
1471deltamedical.huJASKO SYSTEMS s.r.o.2014-11-14 19:01:37részletek
1472termeszetesesbiztonsagos.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:37részletek
1473egyiptomiszobrok.huKiss István2014-11-14 19:01:37részletek
1474eletunkacsalad.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:36részletek
1475termeszetescsaladtervezes.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:36részletek
1476mimapunk.huKároly Róbert2014-11-14 19:01:36részletek
1477oltonynagyker.huGáspár Donát2014-11-14 19:01:36részletek
1478eredetvizsgagod.huMaros Autóház Kft.2014-11-14 19:01:36részletek
1479muszakivizsgagod.huMaros Autóház Kft.2014-11-14 19:01:36részletek
1480gyaligepkolcsonzo.huMarozsán Mihály2014-11-14 19:01:35részletek
1481szulokakademiaja.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:35részletek
1482sensiplan.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:35részletek
1483tcstkozpont.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:35részletek
1484horgaszhelyfoglalas.huKoplányiné Gelencsér Eszter2014-11-14 19:01:35részletek
1485befogadás.huMagyar Máltai Szeretetszolgálat Egyesület2014-11-14 19:01:35részletek
1486krisztinia.huGyenesei Krisztina2014-11-14 19:01:35részletek
1487poitimer.huHome and Living Bt. 2014-11-14 19:01:34részletek
1488szoszerinti.huIpacs és Társa Bt2014-11-14 19:01:34részletek
1489felszerelesberles.huMarrubio Kft.2014-11-14 19:01:34részletek
1490oszhajstop.huNyilas Judit és Társai Bt.2014-11-14 19:01:34részletek
1491vittalicci.huJASKO SYSTEMS s.r.o.2014-11-14 19:01:34részletek
1492pillanat-foto.huKovács Ferenc2014-11-14 19:01:34részletek
1493bornholmkft.huBornholm Project Management Kft.2014-11-14 19:01:34részletek
1494boronline.huBleszity Péter2014-11-14 19:01:34részletek
1495kalandrasopron.huSopron Anno Egyesület2014-11-14 19:01:33részletek
1496kajaklinika.huDaniel Krisztián2014-11-14 19:01:33részletek
1497fronit.huF-RONIT Mérnöki Iroda Bt.2014-11-14 19:01:33részletek
1498prod.huWebtölcsér Kft.2014-11-14 19:01:33részletek
1499csogumi.huWebtölcsér Kft.2014-11-14 19:01:33részletek
1500jelentes.huWebtölcsér Kft.2014-11-14 19:01:33részletek
1501paintech.huSomogyi Péter2014-11-14 19:01:32részletek
1502ledboutiq.huFRANKLIN KFT2014-11-14 19:01:32részletek
1503alkandallo.huKiss István2014-11-14 19:01:32részletek
1504allatfigura.huKiss István2014-11-14 19:01:32részletek
1505buddhaszobrok.huKiss István2014-11-14 19:01:32részletek
1506kertitorpek.huKiss István2014-11-14 19:01:32részletek
1507f-ronit.huF-RONIT Mérnöki Iroda Bt.2014-11-14 19:01:32részletek
1508kockul.huKiss Enikő2014-11-14 19:01:31részletek
1509bestcardvd.huNagy András2014-11-14 19:01:31részletek
1510idealpartner.huLendvai Tamás2014-11-14 19:01:31részletek
1511ledbutiq.bolt.huFRANKLIN KFT2014-11-14 19:01:31részletek
1512jezusszobor.huKiss István2014-11-14 19:01:31részletek
1513reklamfigura.huKiss István2014-11-14 19:01:31részletek
1514fagyireklam.huKiss István2014-11-14 19:01:31részletek
1515designmaker.huARANY KARBON Kft.2014-11-14 19:01:30részletek
1516alpsystem.huFilius Mérnökiroda Kft.2014-11-14 19:01:30részletek
15173dny.huMobis Services Ltd2014-11-14 19:01:30részletek
1518pszichiatria-debrecen.huDr. Móré Elek Csaba2014-11-14 19:01:30részletek
1519pszichoplaza.huDr. Móré Elek Csaba2014-11-14 19:01:30részletek
1520greenrent.huTerhes Csaba2014-11-14 19:01:30részletek
1521huszakzsuzsa.huHuszák Zsuzsa 2014-11-14 19:01:30részletek
1522teflonabrosz.huV&V Merchant Kft.2014-11-14 19:01:29részletek
1523matchstick.huEuroCable Magyarorszag Kft.2014-11-14 19:01:29részletek
1524barathtemetkezes.huBaráth Miklós2014-11-14 19:01:29részletek
1525budaiborbély.huBARBER ART KFT2014-11-14 19:01:29részletek
1526schönecker.huBARBER ART KFT2014-11-14 19:01:29részletek
1527fatbike-life.huArdó Tamás2014-11-14 19:01:29részletek
1528sportegyesulet-somogyvar.huSomogyvár Község Sportegyesület2014-11-14 19:01:29részletek
1529ksquare.huHALCYON Kft2014-11-14 19:01:28részletek
1530koccool.huKiss Enikő2014-11-14 19:01:28részletek
1531dtx-bon.huDtx-Bon Kft.2014-11-14 19:01:28részletek
1532husossomtarsasag.huKreka Dóra2014-11-14 19:01:28részletek
1533hungryhungarian.huKreka Dóra2014-11-14 19:01:28részletek
1534kelto.huTóth Ákos2014-11-14 19:01:28részletek
1535i-crypt.huINTEGRITY Kft.2014-11-14 19:01:28részletek
1536trendypet.huSala-System Bt.2014-11-14 19:01:27részletek
1537hirosbefott.huHírös-Vitál Zrt2014-11-14 19:01:27részletek
1538hiroslekvar.huHírös-Vitál Zrt2014-11-14 19:01:27részletek
1539hirosvital.huHírös-Vitál Zrt2014-11-14 19:01:27részletek
1540lenovowebshop.huMobil-Bár Bt.2014-11-14 19:01:27részletek
1541szoboszlotenisz.huErdei László2014-11-14 19:01:27részletek
1542vonyarckomposzt.huSmartBeer Kft. 2014-11-14 19:01:27részletek
1543drhirt.huDr. Hirt Mihály Ügyvédi Iroda2014-11-14 19:01:26részletek
1544bsafe.huATN Kereskedelmi és Informatikai Kft.2014-11-14 19:01:26részletek
1545munkakeresoproba.huHeineken Hungária Sörgyárak Zrt.2014-11-14 19:01:26részletek
1546immighealth.huDr. Marek Erika2014-11-14 19:01:26részletek
1547allaskeresoproba.huHeineken Hungária Sörgyárak Zrt.2014-11-14 19:01:26részletek
1548attivo.huAttivo Trend Kft.2014-11-14 19:01:26részletek
1549hpanorama.huSynaptx Bt.2014-11-14 19:01:25részletek
1550dhlakcio.huMARKWEB Kft.2014-11-14 19:01:25részletek
1551wpweboldal.huK2 Group Kft2014-11-14 19:01:25részletek
1552langlegal.huK2 Group Kft2014-11-14 19:01:25részletek
1553othonangyal.huE.ON Energiakereskedelmi Kft.2014-11-14 19:01:25részletek
1554otthonanygyal.huE.ON Energiakereskedelmi Kft.2014-11-14 19:01:25részletek
1555stade.huDobosi Gábor2014-11-14 19:01:24részletek
1556palinkas-bonbon.huKreka Dóra2014-11-14 19:01:24részletek
1557bonbonasz.huKreka Dóra2014-11-14 19:01:24részletek
1558ciprusiszallasok.huBankihitelek.hu Kft.2014-11-14 19:01:24részletek
1559sevenspiritchocolate.huKreka Dóra2014-11-14 19:01:24részletek
1560benyhe.huBenyhe Gábor2014-11-14 19:01:24részletek
1561dron-security.huFarkas István2014-11-14 19:01:23részletek
1562dronbazis.huFarkas István2014-11-14 19:01:23részletek
1563joflotta.huARANY KARBON Kft.2014-11-14 19:01:23részletek
1564rekrea.huPiller róbert egyéni vállalkozó2014-11-14 19:01:23részletek
1565somtarsasag.huKreka Dóra2014-11-14 19:01:23részletek
1566mrpalinka.huKreka Dóra2014-11-14 19:01:23részletek
1567gepjarmu-karrendezes.huHorizon Média Kft.2014-11-14 19:01:23részletek
1568glamping-hungary.huEXITY Kft.2014-11-14 19:01:23részletek
1569legolcsobbpenztargep.huNazza Software Kft.2014-11-14 19:01:22részletek
1570lomtalanitas-ingyen.huKozák János2014-11-14 19:01:22részletek
1571halterkep.huKoncz Balázs2014-11-14 19:01:22részletek
1572ott-1.huEuroCable Magyarorszag Kft.2014-11-14 19:01:22részletek
1573ott-one.huEuroCable Magyarorszag Kft.2014-11-14 19:01:22részletek
1574graviola.bolt.huWebprosper kft.2014-11-14 19:01:22részletek
1575autoszerelopenztargep.huNazza Software Kft.2014-11-14 19:01:21részletek
1576mediatorgyor.huERANGER Tanácsadó és Szolgáltató Kft.2014-11-14 19:01:21részletek
1577pillanovesztes.huBeauty Partner Kft.2014-11-14 19:01:21részletek
1578longlashes4ever.huBeauty Partner Kft.2014-11-14 19:01:21részletek
1579longlashesforever.huBeauty Partner Kft.2014-11-14 19:01:21részletek
1580ottegy.huEuroCable Magyarorszag Kft.2014-11-14 19:01:21részletek
1581asr.huKosztyu Bence András2014-11-14 19:01:20részletek
1582pharmako.huPharmako Kft.2014-11-14 19:01:20részletek
1583pecaterkep.huKoncz Balázs2014-11-14 19:01:20részletek
1584duguláselhárítás-eger.huSári Péter2014-11-14 19:01:20részletek
1585csaladpedagogia.huÉLETÜNK A CSALÁD! Nonprofit Közhasznú Kft.2014-11-14 19:01:20részletek
1586graveman.huPánik Kulturális Egyesület2014-11-14 19:01:20részletek
1587swingerhajo.huSzabó László2014-11-14 19:01:19részletek
1588kozmetikuspenztargep.huAlt Cash Kft.2014-11-14 19:01:19részletek
1589orvospenztargep.huAlt Cash Kft.2014-11-14 19:01:19részletek
1590fodraszpenztargep.huAlt Cash Kft.2014-11-14 19:01:19részletek
1591adampont.huÁdám Imre2014-11-14 19:01:19részletek
1592levendulaviz.huBiczó Attila2014-11-14 19:01:18részletek
1593intsoft.huINT-Soft Bt.2014-11-14 19:01:18részletek
1594kozmetikus-penztargep.huAlt Cash Kft.2014-11-14 19:01:18részletek
1595log-on.huBinova Trade Kft2014-11-14 19:01:18részletek
1596orvos-penztargep.huAlt Cash Kft.2014-11-14 19:01:18részletek
1597fodrasz-penztargep.huAlt Cash Kft.2014-11-14 19:01:18részletek
1598greendrogerie.huPure Web Vision Bt.2014-11-14 19:01:18részletek
1599spiritgroup.huBuda Immo Ingatlanforgalmazó Kft2014-11-14 19:01:17részletek
1600gsandor.huGelencsér Sándor2014-11-14 19:01:17részletek
1601zarjavitas-zarcsere.huGMedia Kereskedelmi és Szolgáltató Kft.2014-11-14 19:01:17részletek
1602musickey.huBiczó Attila2014-11-14 19:01:17részletek
1603kyoritsu.huServintern Bt.2014-11-14 19:01:17részletek
1604nonshepherd.huPánik Kulturális Egyesület2014-11-14 19:01:17részletek
1605lezerfenyszoro.huPaál János2014-11-14 19:01:16részletek
1606legjobbhotelarak.huSomogyi Krisztina2014-11-14 19:01:16részletek
1607achskaroly.huAchs Károly 2014-11-14 19:01:16részletek
1608boulder.huIngatlanhirdetés Kft2014-11-14 19:01:16részletek
1609infoanimacio.huVisionary 7 Kft.2014-11-14 19:01:16részletek
1610xbodygold.huJakab József 2014-11-14 19:01:16részletek
1611elsosegely60.huT&M IT Solutions Kft.2014-11-14 19:01:16részletek
1612szimplaklíma.huSeo Lab Kft.2014-11-14 19:01:16részletek
1613egyhaztortenetiszemle.huSárospataki Református Kollégium Tudományos Gyűjteményei2014-11-14 19:01:15részletek
1614harmonybalance.huSzamay Andrea2014-11-14 19:01:15részletek
1615sieljitthon.huLAVINA-SPORT Kft.2014-11-14 19:01:15részletek
1616hiros-vital.huHírös-Vitál Zrt2014-11-14 19:01:15részletek
1617redekomposzt.huSmartBeer Kft. 2014-11-14 19:01:15részletek
1618outletpark.huPOT mobile Kft.2014-11-14 19:01:14részletek
1619kertigepjavito.huKirály Ernő2014-11-14 19:01:14részletek
1620borzekor.huNagy Orsolya2014-11-14 19:01:14részletek
1621dunaujvaros-gumiszerviz.huMaticza Krisztián2014-11-14 19:01:14részletek
1622serin.huKerro Zsuzsanna Serin2014-11-14 19:01:14részletek
1623szifo.huKLIK 054002 2014-11-14 19:01:14részletek
1624elegantruhaszerviz.huTóth Árpád2014-11-14 19:01:13részletek
1625regio.film.huBalogh Sándor2014-11-14 19:01:13részletek
1626dermotox.huDermotox Kft.2014-11-14 19:01:13részletek
1627egyuttaradnotiert.huKocsis Zoltán2014-11-14 19:01:13részletek
1628jatekx.huVertika Alkalmazás-szolgáltató Kft.2014-11-14 19:01:13részletek
1629brightinstruction.huSzilágyi Árpád2014-11-14 19:01:13részletek
1630asteriafoto.huAjtai Róbert2014-11-14 19:01:12részletek
1631brand-on.huLÁK Kft2014-11-14 19:01:12részletek
1632klickstart.huevopay Kft.2014-11-14 19:01:12részletek
1633huvelyszukites.huDermotox Kft.2014-11-14 19:01:12részletek
1634deyo.huKóczián Péter2014-11-14 19:01:12részletek
1635viragvadasz.huNagy Olivér2014-11-14 19:01:12részletek
1636cserhatertekeiert.huCserhát Természeti És Kult. Ért. Al.2014-11-14 19:01:12részletek
1637intimlezer.huDermotox Kft.2014-11-14 19:01:11részletek
1638igenpecs.huKreater-csoport Társadalmi Innovációs Labor Kft.2014-11-14 19:01:11részletek
1639green-drogerie.huPure Web Vision Bt.2014-11-14 19:01:11részletek
1640elmenygarancia.huBigDay Kft.2014-11-14 19:01:11részletek
1641sztferencleanyai.huMiliczká Gabriela2014-11-14 19:01:11részletek
1642idatastart.huMaxalarm Kft. 2014-11-14 19:01:11részletek
1643lakastveszek.huRómai Atelier Bt2014-11-14 19:01:10részletek
1644bhsolutions.hu B&H Solutions Kft.2014-11-14 19:01:10részletek
1645mannabio.huHorváth Gabriella2014-11-14 19:01:10részletek
1646pszichiatriadebrecen.huDr. Móré Elek Csaba2014-11-14 19:01:10részletek
1647élménygarancia.huBigDay Kft.2014-11-14 19:01:10részletek
1648cipeszpenztargep.huNazza Software Kft.2014-11-14 19:01:09részletek
1649lgenergia.huLG Energia Kft.2014-11-14 19:01:09részletek
1650gazvezetekfelujitas.huDr. Magehneim Mónika2014-11-14 19:01:09részletek
1651vinczenet.huVincze István2014-11-14 19:01:09részletek
1652n44.huGyalus Katalin 2014-11-14 19:01:09részletek
1653adatsztori.huHuszthy Gergely Balázs2014-11-14 19:01:09részletek
1654dimona.huSzabó Zsolt2014-11-14 19:01:08részletek
1655ajandektenger.huCreative Store Hungary Kft.2014-11-14 19:01:08részletek
1656kalkulus.huKrix Zoltánné2014-11-14 19:01:08részletek
1657myspaconsulting.huBuda Immo Ingatlanforgalmazó Kft2014-11-14 19:01:08részletek
1658paleo-cukraszda.huPályi Nóra2014-11-14 19:01:08részletek
1659medchat.huObjection Kft.2014-11-14 19:01:08részletek
1660evopayplusz.huevopay Kft.2014-11-14 19:01:07részletek
1661enterosgel.bolt.huWebprosper kft.2014-11-14 19:01:07részletek
1662alexbazar.huSDP Hungária Kft.2014-11-14 19:01:07részletek
1663stevie.huUnidomain Kft.2014-11-14 19:01:07részletek
1664szimpla-klíma.huSeo Lab Kft.2014-11-14 19:01:07részletek
1665szonyeg-webaruhaz.huSzőnyegáruház-Székelyi János Antal EV 2014-11-14 19:01:07részletek
1666inyk-somogyvar.huSomogyvár Község Önkormányzata2014-11-14 19:01:06részletek
1667extratarhely.huNaviMaster Kft.2014-11-14 19:01:06részletek
1668klickup.huevopay Kft.2014-11-14 19:01:06részletek
1669noridesszertmanufaktura.huPályi Nóra2014-11-14 19:01:06részletek
1670barczybeatrix.huUgron István2014-11-14 19:01:06részletek
1671buzajanos.huBuza János2014-11-14 19:01:05részletek
16723dn.huMobis Services Ltd2014-11-14 19:01:05részletek
1673atoslombardini.huLombardini SPA2014-11-14 19:01:05részletek
1674magyarlektor.huFábián Orsolya2014-11-14 19:01:05részletek
1675zold-drogeria.huPure Web Vision Bt.2014-11-14 19:01:05részletek
1676higiker.huHigi-Ker Kft.2014-11-14 19:01:04részletek
1677lakast-veszek.huRómai Atelier Bt2014-11-14 19:01:04részletek
1678kinosoft.huMobilSoft Bt.2014-11-14 19:01:04részletek
1679autoclick.huUhljar Zsolt András2014-11-14 19:01:04részletek
1680medianoise.huBán Attila2014-11-14 19:01:04részletek
1681pakozdikecskesajt.huKádas Róbert2014-11-14 19:01:04részletek
1682sid.huUnidomain Kft.2014-11-14 19:01:03részletek
1683gadgetcoin.huNagy Szilárd2014-11-14 19:01:03részletek
1684weddingpaper.huFekete Zita2014-11-14 19:01:03részletek
1685soterfitness.huSoter-Line Kft.2014-11-14 19:01:03részletek
1686nfaf.huDelta Velorum Kft.2014-11-14 19:01:03részletek
1687herbaliget.huVarga Eszter EV2014-11-14 19:01:03részletek
1688guesshungary.huAVENUE SHOPPING Kft.2014-11-14 19:01:03részletek
1689alapellato.huIncomed KFT.2014-11-14 19:01:02részletek
1690kaltenbach.huUnidomain Kft.2014-11-14 19:01:02részletek
1691kometa2001.huKrix Zoltánné2014-11-14 19:01:02részletek
1692officeart.huBánhidai Zsolt2014-11-14 19:01:02részletek
1693ballagobal.huDelta Velorum Kft.2014-11-14 19:01:02részletek
1694debrecentv.huRaycom-GTE Kft2014-11-14 19:01:01részletek
1695foodtransit.huDiamond Bridge Hungary Kft2014-11-14 19:01:01részletek
1696karancsi.huKarancsi Gábor2014-11-14 19:01:01részletek
1697otca.huÓtca Ingatlan-forgalmazó és -fejlesztő Kft 2014-11-14 19:01:01részletek
1698goodguytaxi.huFehérdi Tamás2014-11-14 14:01:18részletek
1699ek-partner.huCzézár Csanád2014-11-14 14:01:18részletek
1700drbaran.huDr. Baran Alexandra2014-11-14 14:01:17részletek
1701infrafutespanel.huJoy Design Studio Kft.2014-11-14 14:01:17részletek
1702nsec.huBeregszászi Mihály Csaba2014-11-14 14:01:17részletek
1703dayzonline.huMárkus Péter2014-11-14 14:01:17részletek
1704punchy.huKözép- és Kelet-Európai Történelem és Társadalom Kutatásáért Közalapítvány2014-11-14 14:01:17részletek
1705bor4me.hudoX GROUP Kft.2014-11-14 14:01:17részletek
1706eszakdel.huDr. Bördős Éva2014-11-14 14:01:17részletek
1707hutlenseg.huMészáros Mediátor Iroda Kft. 2014-11-14 14:01:16részletek
1708piroslapmozgalom.huSzabolcsnet Bt.2014-11-14 14:01:16részletek
1709strandfahne.huTom-Tom Storage Kft.2014-11-14 14:01:16részletek
1710marcaliplast.huMarcali László2014-11-14 14:01:16részletek
1711napelemshop.huTőkés Ernő 2014-11-14 14:01:16részletek
1712fogás.huSchibsted Classified Media Hungary Kft.2014-11-14 14:01:16részletek
1713notebookboltom.huWindsystem Kft.2014-11-14 14:01:16részletek
1714vasarnapisnyitva.huMORAKO-Ker Kft.2014-11-14 14:01:15részletek
1715akadalyozott.huNagy Miklós2014-11-14 14:01:15részletek
1716vietnam-hydroprojekt.hu Vietnam-Hydroprojekt Kft.2014-11-14 14:01:15részletek
1717nogradfold.huNógrád Föld Szociális Szövetkezet2014-11-14 14:01:15részletek
1718hidszovetseg.huGál László2014-11-14 14:01:15részletek
1719eljamesauthor.huEuroCable Magyarorszag Kft.2014-11-14 14:01:15részletek
1720webviki.huCzézár Csanád2014-11-14 14:01:15részletek
1721hirdetespanel.huKern Gábor2014-11-14 14:01:15részletek
1722a11y.huWebsupport s.r.o.2014-11-14 14:01:14részletek
1723accessibleux.huWebsupport s.r.o.2014-11-14 14:01:14részletek
1724angyalszappan.huPintér Zsuzsanna2014-11-14 14:01:14részletek
1725feltekenyseglexikon.huMészáros Mediátor Iroda Kft. 2014-11-14 14:01:14részletek
1726bits.huNémeth Sándor2014-11-14 14:01:14részletek
1727szimocsemege.huMolnár László2014-11-14 14:01:14részletek
1728chippendale-thomas.huTamás Attila2014-11-14 14:01:14részletek
1729aluereszcsatorna.huTornyai Viktor2014-11-14 14:01:14részletek
1730accessibility.huWebsupport s.r.o.2014-11-14 14:01:13részletek
1731cheapen.huTeszár Tibor2014-11-14 14:01:13részletek
1732kecskemet-coaching.huRácz Anikó Judit2014-11-14 14:01:13részletek
1733anico-vertexstandard.huAnico Kft.2014-11-14 14:01:13részletek
1734pvsp.huPlayer VS. Player Kft. 2014-11-14 14:01:13részletek
1735strandflaggen.huTom-Tom Storage Kft.2014-11-14 14:01:13részletek
1736balintmasszazs.huMonori Anikó2014-11-14 14:01:13részletek
1737akadalymentesux.huWebsupport s.r.o.2014-11-14 14:01:12részletek
1738helyitv.huLajos Dániel 2014-11-14 14:01:12részletek
1739elmenyszallas.huSomodi Gábor2014-11-14 14:01:12részletek
1740megcsalaslexikon.huMészáros Mediátor Iroda Kft. 2014-11-14 14:01:12részletek
1741fonyodfishing.huRácz Dávid2014-11-14 14:01:12részletek
1742webgate.huÁbrahám Rudolf2014-11-14 14:01:12részletek
1743startprogram.huMáté Ildikó2014-11-14 14:01:12részletek
1744fahnen.huTom-Tom Storage Kft.2014-11-14 14:01:11részletek
1745zsizsisuti.huZSIZSI-SÜTI Kft.2014-11-14 14:01:11részletek
1746kukatunder.huCommitment Zrt.2014-11-14 14:01:11részletek
1747gubbio.huKupás Tibor2014-11-14 14:01:11részletek
1748budaligetikisbolt.huSebestyén Beatrix2014-11-14 14:01:11részletek
1749mentesnasi.huRóka és tsa. Bt.2014-11-14 14:01:11részletek
1750diszlexialap.huOculo-Cor Kft.2014-11-14 14:01:11részletek
1751jokerjatek.huSzerencsejatek Zrt.2014-11-14 14:01:11részletek
1752satkabel.huLajos Dániel 2014-11-14 14:01:10részletek
1753geprongyfutar.huBoldog Imre2014-11-14 14:01:10részletek
1754fahne.huTom-Tom Storage Kft.2014-11-14 14:01:10részletek
1755174-skiallitasok.huKuti Péter2014-11-14 14:01:10részletek
1756gnosus.huDavid Farsky2014-11-14 14:01:10részletek
1757magiatrans.huMágia Trans KFT2014-11-14 14:01:10részletek
1758bkvzó.huBaki Béla2014-11-14 14:01:10részletek
1759gyomrorisk.huBradács Ágnes 2014-11-14 14:01:10részletek
1760beszelokepek.huKuti Péter2014-11-14 14:01:09részletek
1761korea-heating.huDimat Fűtéstechnika Kft2014-11-14 14:01:09részletek
1762bucsuskalyha.huBúcsús József2014-11-14 14:01:09részletek
1763tyres2c.huTyres In Stock Europe BV2014-11-14 14:01:09részletek
1764motoros-tura.huAnonymouse Domains s.r.o.2014-11-14 14:01:09részletek
1765joblog.huAnonymouse Domains s.r.o.2014-11-14 14:01:09részletek
1766csaszareszti.huÁgfalvi János2014-11-14 14:01:09részletek
1767mediatorlexikon.huMészáros Mediátor Iroda Kft. 2014-11-14 14:01:08részletek
1768flagshop.huTom-Tom Storage Kft.2014-11-14 14:01:08részletek
1769pedalracing.huTobak Zoltán2014-11-14 14:01:08részletek
1770szamitogepteszt.huMarosvölgyi Márk2014-11-14 14:01:08részletek
1771raycop.huPintér László2014-11-14 14:01:08részletek
1772hotfilm.huDimat Fűtéstechnika Kft2014-11-14 14:01:08részletek
1773koreaheating.huDimat Fűtéstechnika Kft2014-11-14 14:01:08részletek
1774szepleszelbeauty.huTrend Plusz Media Kft2014-11-14 14:01:07részletek
1775eskuvodlesz.huFüzesi Zoltán E.V.2014-11-14 14:01:07részletek
1776prefixbox.huSimon István2014-11-14 14:01:07részletek
1777daliabutor.huFAPROFI-L Bt.2014-11-14 14:01:07részletek
1778hardvertesztek.huMarosvölgyi Márk2014-11-14 14:01:07részletek
1779g2apay.huEuroDNS S.A.2014-11-14 14:01:06részletek
1780coachlexikon.huMészáros Mediátor Iroda Kft. 2014-11-14 14:01:06részletek
1781kolcsonautokecskemet.huAutó 2005 Kft.2014-11-14 14:01:06részletek
1782beyoeskuvo.huLengyeltótiné Lajos Beáta2014-11-14 14:01:06részletek
1783csakte.huKarpf András2014-11-14 14:01:06részletek
1784autodaruzasheviz.huZalaWare Kft2014-11-14 14:01:06részletek
1785kamionsoforallas.huEuroDNS S.A.2014-11-14 14:01:05részletek
1786gumi-karkoto.huJakab László E.V.2014-11-14 14:01:05részletek
1787strandfahnen.huTom-Tom Storage Kft.2014-11-14 14:01:05részletek
1788flagge.huTom-Tom Storage Kft.2014-11-14 14:01:05részletek
1789beachflags.huTom-Tom Storage Kft.2014-11-14 14:01:05részletek
1790beachflag.huTom-Tom Storage Kft.2014-11-14 14:01:05részletek
1791softelle.huBerta-Kis Anikó2014-11-14 14:01:05részletek
1792myspahotel.huBuda Immo Ingatlanforgalmazó Kft2014-11-14 14:01:04részletek
1793spiritholding.huBuda Immo Ingatlanforgalmazó Kft2014-11-14 14:01:04részletek
1794aprobolt.huNagyné Zatik Marianna2014-11-14 14:01:04részletek
1795mydate.huKarpf András2014-11-14 14:01:04részletek
1796angyaliarcok.huMester Hungária Kft.2014-11-14 14:01:04részletek
1797andykozmetika.hu Jócsák Andrea2014-11-14 14:01:04részletek
1798kamoo.huRappold Krisztina2014-11-14 14:01:04részletek
1799kompoziciokft.huKOMPOZICIO Ipari,Mezőgazdasági és Kereskedelmi Kft.2014-11-14 14:01:04részletek
1800greensystem.huBILOME Kft.2014-11-14 14:01:03részletek
1801totumfaktum.huTóth Ferenc2014-11-14 14:01:03részletek
1802guideofbudapest.huKleyer Éva2014-11-14 14:01:03részletek
1803zolddrogeria.huPure Web Vision Bt.2014-11-14 14:01:03részletek
1804deltasze.huMlions2014-11-14 14:01:03részletek
1805framework.huKohl Zsuzsanna2014-11-14 14:01:03részletek
1806bkvézó.huBaki Béla2014-11-14 14:01:03részletek
1807bekavezo.huBaki Béla2014-11-14 14:01:03részletek
1808vnhp.hu Vietnam-Hydroprojekt Kft.2014-11-14 14:01:02részletek
1809brainlab.huSteiger Ákos2014-11-14 14:01:02részletek
1810petofilive.huÚj Média és Teletext Szolgáltató Kft2014-11-14 14:01:02részletek
1811lilafrezia.huLila Frézia Bt.2014-11-14 14:01:02részletek
1812balettcipo.huKiberNet Kft.2014-11-14 14:01:02részletek
1813kelengyewebshop.huKatona István ev.2014-11-14 14:01:01részletek
1814fovarosbisztro.huTékosz Kereskedelmi Bt.2014-11-13 23:01:13részletek
1815nyirofejelezes.huSelBruHa Állatgyógyászati fejlesztõ, Kereskedelmi és Tanácsadó Szolg. Kft.2014-11-13 23:01:13részletek
1816kerekparcipo.huBringaboard Trekking-City Kft.2014-11-13 23:01:13részletek
1817laptopboltom.huWindsystem Kft.2014-11-13 23:01:13részletek
1818sksoft.huComputing Systems Informatikai Korlátolt Felelősségű Társaság 2014-11-13 23:01:13részletek
1819scrapbookhobby.huHajdú Zsoltné2014-11-13 23:01:12részletek
1820kulcs-mento.huSecret and Climbing Hungray Kft2014-11-13 23:01:12részletek
1821talalkozasipont.huSchibsted Classified Media Hungary Kft.2014-11-13 23:01:12részletek
1822budapestxmas.huHamu és Gyémánt Kft.2014-11-13 23:01:12részletek
1823irinavirag.huSzabó László Balázs2014-11-13 23:01:12részletek
1824mav-lv.huMÁV Szolgáltató Központ Zrt.2014-11-13 23:01:12részletek
1825latoszogblog.huÚj Média és Teletext Szolgáltató Kft2014-11-13 23:01:12részletek
1826polarblog.huIT & Coffee Kft.2014-11-13 23:01:11részletek
1827playvideogame.huHarcsa Péter EV2014-11-13 23:01:11részletek
1828jatekforgo.huVertika Alkalmazás-szolgáltató Kft.2014-11-13 23:01:11részletek
1829kutyaswebaruhaz.huNagy Gábor EV.2014-11-13 23:01:11részletek
1830nadaspal.huNádas Pál2014-11-13 23:01:11részletek
1831szamitogepszervizem.huWindsystem Kft.2014-11-13 23:01:11részletek
1832szamitogepboltom.huWindsystem Kft.2014-11-13 23:01:11részletek
1833pandipekseg.huPándi Pékség Termelő, Szolgáltató és Kereskedő Bt.2014-11-13 23:01:10részletek
1834bmwbonto.co.huBánlaki Zsolt2014-11-13 23:01:10részletek
1835sinfonic.huBodó Zajzon2014-11-13 23:01:10részletek
1836vw-garage.huSDS Autó Bt2014-11-13 23:01:10részletek
1837suzukialkatreszshop.huRolling Box Hungary Kft. 2014-11-13 23:01:10részletek
1838secondhandgame.huVertika Alkalmazás-szolgáltató Kft.2014-11-13 23:01:10részletek
1839iranydarany.huSomogyi Zsuzsanna2014-11-13 23:01:10részletek
1840kisbecs.huAT WEIN Kft.2014-11-13 23:01:09részletek
1841kettfit.huIT & Coffee Kft.2014-11-13 23:01:09részletek
1842fozzkonnyen.huEUVÁL Kft2014-11-13 23:01:09részletek
1843muscle-sport.huADITIVA CZ s.r.o.2014-11-13 23:01:09részletek
1844kulcsmento.huSecret and Climbing Hungray Kft2014-11-13 23:01:09részletek
1845onszeretet.huKabai József2014-11-13 23:01:09részletek
1846joserakutyatap.huNagy Gábor EV.2014-11-13 23:01:09részletek
1847osztrakbor.huAT WEIN Kft.2014-11-13 23:01:08részletek
1848salatazo.huAT WEIN Kft.2014-11-13 23:01:08részletek
1849salatazobudan.huAT WEIN Kft.2014-11-13 23:01:08részletek
1850reggelizobudan.huAT WEIN Kft.2014-11-13 23:01:08részletek
1851reggelibudan.huAT WEIN Kft.2014-11-13 23:01:08részletek
1852ausztriaborai.huAT WEIN Kft.2014-11-13 23:01:08részletek
1853miborsodiakegymasert.hu„Mi Borsodiak Egymásért” Szociális Szövetkezet2014-11-13 23:01:08részletek
1854soulstation.huFüller Tünde E.V.2014-11-13 23:01:07részletek
1855soulstationradio.huFüller Tünde E.V.2014-11-13 23:01:07részletek
1856domipack-shop.huDomi-Pack Kereskedelmi Kft.2014-11-13 23:01:07részletek
1857senyi.huNagyunyomi-Sényi Gergely2014-11-13 23:01:07részletek
1858sgaming.huFarkas Veronika Csilla2014-11-13 23:01:07részletek
1859istertrade.huAleksza György2014-11-13 23:01:07részletek
1860aegonugyfelszolgalat.huAegon Magyarország Általános Biztosító Zrt.2014-11-13 23:01:07részletek
1861borbudan.huAT WEIN Kft.2014-11-13 23:01:07részletek
1862bérelj-marketingest.huSTEMO Marketing Kft.2014-11-13 23:01:06részletek
1863berelj-marketingest.huSTEMO Marketing Kft.2014-11-13 23:01:06részletek
1864patrikart.huTelepóczki Evelin2014-11-13 23:01:06részletek
1865foldmunka-szallitmanyozas.huKántás Transport Kft.2014-11-13 23:01:06részletek
1866onegyutterzes.huKabai József2014-11-13 23:01:06részletek
1867udgeschichte.huKoch Valéria Gimnázium, Általános Iskola, Óvoda, Kollégium és Pedagógiai Intézet2014-11-13 23:01:06részletek
1868sziget-papir.huDalmadiné Kiss Ildikó2014-11-13 23:01:06részletek
1869fovarosbufe.huTékosz Kereskedelmi Bt.2014-11-13 23:01:05részletek
1870massivum.huWebsupport s.r.o.2014-11-13 23:01:05részletek
1871dtky.huDr. Dutkay György2014-11-13 23:01:05részletek
1872szempillaszepito.huMalinovszky László2014-11-13 23:01:05részletek
1873wphoto.huWerni Gábor2014-11-13 23:01:05részletek
1874petofiplusz.huÚj Média és Teletext Szolgáltató Kft2014-11-13 23:01:05részletek
1875vesav.huÁbrahám Rudolf2014-11-13 23:01:04részletek
1876vanhelyem.huTápai Zoltán2014-11-13 23:01:04részletek
1877arpadszabo.huSzabó Árpád2014-11-13 23:01:04részletek
1878bigiholz.huNémeth Ákos2014-11-13 23:01:04részletek
1879cempx.huLS Media Network Kft.2014-11-13 23:01:04részletek
1880kutya-sampon.huSelBruHa Állatgyógyászati fejlesztõ, Kereskedelmi és Tanácsadó Szolg. Kft.2014-11-13 23:01:04részletek
1881luxorjatek.huSzerencsejatek Zrt.2014-11-13 23:01:04részletek
1882koltoztetesnemmakezdtuk.huOstarius Studio Bt.2014-11-13 23:01:04részletek
1883hiro2.huKolarovszki Márk2014-11-13 23:01:03részletek
1884huneagle.huHun-Eagle Szociális Szövetkezet2014-11-13 23:01:03részletek
1885langokrisztina.huLangó Krisztina2014-11-13 23:01:03részletek
1886krisztinalango.huLangó Krisztina2014-11-13 23:01:03részletek
1887oszapo.huÓvári Sándor E.V. 2014-11-13 23:01:03részletek
1888urbansiremlek.huUrbán István2014-11-13 23:01:03részletek
1889froccskocsma.huSzabó Péter2014-11-13 23:01:03részletek
1890malinovka.huYUDAM Kereskedelmi és Szolgáltató Korlátolt Felelősségű Társaság2014-11-13 23:01:02részletek
1891sinzoo.huSintár Gábor2014-11-13 23:01:02részletek
1892otletcentrum.huBakó Gábor e.v.2014-11-13 23:01:02részletek
1893celerio.huTomportál Bt.2014-11-13 23:01:02részletek
1894artheros.huBirinyi Márton2014-11-13 23:01:02részletek
1895riversidechurch.huGener-It Bt.2014-11-13 23:01:02részletek
1896classicduo.huNagy Sándor2014-11-13 23:01:01részletek
1897benemedico.huBenemedico Kft.2014-11-13 23:01:01részletek
1898kisbagett.huMólósétány Kft.2014-11-13 23:01:01részletek
1899kiscsatos.huMólósétány Kft.2014-11-13 23:01:01részletek
1900gyamc.huGyőri Automobil és Motor Club Veteránjármű Egyesület2014-11-13 23:01:01részletek
1901redonygyor.huRutai Sándor2014-11-13 19:01:20részletek
1902fficoop.huMihályi László2014-11-13 19:01:20részletek
1903focus-on.huHelp & Care Szolgáltató Kft.2014-11-13 19:01:20részletek
1904hungaricon.huNyisztor Zsófia2014-11-13 19:01:19részletek
1905napszinpad.huInstar Interactive Kft.2014-11-13 19:01:19részletek
1906horgolasok.huMadarász Viktor2014-11-13 19:01:19részletek
1907hogyerzimagat.huIDS Medical Kft2014-11-13 19:01:18részletek
1908hogyvagyunk.huIDS Medical Kft2014-11-13 19:01:18részletek
1909sztarcsemetek.huBartalovics ildikó2014-11-13 19:01:18részletek
1910kenyelemstudio.huBodor József ev.2014-11-13 19:01:18részletek
1911székelybicska.huFábián László2014-11-13 19:01:18részletek
1912szekelybicska.huFábián László2014-11-13 19:01:18részletek
1913imageforyou.huKrebsz Áron2014-11-13 19:01:18részletek
1914nistoraniko.huNistor Anikó Mária2014-11-13 19:01:17részletek
1915nyiregyhazicsaladikor.huMegaweb kft2014-11-13 19:01:17részletek
1916kreativokvilaga.huKangúr Márk2014-11-13 19:01:17részletek
1917sorteritok.huTápai Gábor Róbert2014-11-13 19:01:17részletek
1918sorterito.huTápai Gábor Róbert2014-11-13 19:01:17részletek
1919mosolyvirag.huMegaweb kft2014-11-13 19:01:17részletek
1920ctm-kerekpar.huBartusné Petkó Marietta2014-11-13 19:01:17részletek
1921amazonkorut.huAmazon Travel Kft.2014-11-13 19:01:16részletek
1922eljamesaziro.huEuroCable Magyarorszag Kft.2014-11-13 19:01:16részletek
1923vancsesz.huMegaweb kft2014-11-13 19:01:16részletek
1924noenyiregyhaza.huMegaweb kft2014-11-13 19:01:16részletek
1925holmikolcsonzo.huSpirit & Wine Hungary Kft2014-11-13 19:01:16részletek
1926milegyekhanagyleszek.huSpirit & Wine Hungary Kft2014-11-13 19:01:16részletek
1927amaryllisz.huAMG-Car Kft.\t2014-11-13 19:01:16részletek
1928passador.huASP Invest Kft.2014-11-13 19:01:15részletek
1929nagykalloinagycsaladosok.huMegaweb kft2014-11-13 19:01:15részletek
1930globocom.huSzerbin Éva2014-11-13 19:01:15részletek
1931autoaddikt.huWiedermann Károly2014-11-13 19:01:15részletek
1932fnt.huFerr-Nívó Kft2014-11-13 19:01:15részletek
1933arapara.huGalocaffe KFT2014-11-13 19:01:14részletek
1934miniaturkert.huJóba Katalin2014-11-13 19:01:14részletek
1935marketingcoach.huBond&Peel Marketing Kft.2014-11-13 19:01:14részletek
1936gelabor.huHorváth Erika2014-11-13 19:01:14részletek
19372livehere.huSzerbin Éva2014-11-13 19:01:14részletek
1938otletdoboz.huBenyusz Csilla2014-11-13 19:01:14részletek
1939profiköltöztetés.huProfi Költöztető Kft2014-11-13 19:01:13részletek
1940katikert.huJóba Katalin2014-11-13 19:01:13részletek
1941animac.huAnimatus Tanácsadó és Kereskedelmi Kft.2014-11-13 19:01:13részletek
1942benart.huGál Benjámin2014-11-13 19:01:13részletek
1943szenteltiz.huTápai Attila Csaba2014-11-13 19:01:13részletek
1944egeszsegesbudapest.huSzvitek Tamás 2014-11-13 19:01:13részletek
1945bereljmarketingest.huSTEMO Marketing Kft.2014-11-13 19:01:12részletek
1946devonrent.huBálint Ákos2014-11-13 19:01:12részletek
1947kolibrincse.huMegaweb kft2014-11-13 19:01:12részletek
1948vitabio.huMizsei Berta EV.2014-11-13 19:01:12részletek
1949stop98.huIlek Lászlóné2014-11-13 19:01:12részletek
1950exertustrade.huExertus Trade Kft2014-11-13 19:01:12részletek
1951frisstej.huUnidomain Kft.2014-11-13 19:01:12részletek
1952zoldenergiapont.huZÁ-RO Bt. 2014-11-13 19:01:11részletek
1953béreljmarketingest.huSTEMO Marketing Kft.2014-11-13 19:01:11részletek
1954szaunashop.huBakos Dániel2014-11-13 19:01:11részletek
1955safranykert.huSáfránykert Kft2014-11-13 19:01:11részletek
1956pievraoffices.huPievra Offices Kft2014-11-13 19:01:11részletek
1957redony-szentendre.huRutai Sándor2014-11-13 19:01:11részletek
1958automentoborsod.huPorkoláb Péter 2014-11-13 19:01:11részletek
1959borsodautomento.huPorkoláb Péter 2014-11-13 19:01:11részletek
1960nyugdijkell.huFüggetlen pénzügyi tanácsadó Kft.2014-11-13 19:01:10részletek
1961ado-kedvezmeny.huKiss Péter2014-11-13 19:01:10részletek
1962shaggyszonyeg.huMártha János Dávid2014-11-13 19:01:10részletek
1963taptalaj.huUnidomain Kft.2014-11-13 19:01:10részletek
1964mokkart.huDobrosi Eszter2014-11-13 19:01:10részletek
1965hondaszeged.huExport Commerce Kft.2014-11-13 19:01:10részletek
1966borsodberauto.huPorkoláb Péter 2014-11-13 19:01:10részletek
1967webdrogeria.huSylvia Hungary Team Kft2014-11-13 19:01:09részletek
1968szeged-nyelviskola.huProfi Profil KFT2014-11-13 19:01:09részletek
1969reumatologiaszekesfehervar.huSaldinvest Kft.2014-11-13 19:01:09részletek
1970adotervezo.huPozsonyi Roland EV.2014-11-13 19:01:09részletek
1971dorosattila.huDorosmed Kft.2014-11-13 19:01:09részletek
1972automentomiskolc.huPorkoláb Péter 2014-11-13 19:01:09részletek
1973dumapont.huSzabó Endre2014-11-13 19:01:08részletek
1974drszaniszlougyved.huDr. Szaniszló Dániel2014-11-13 19:01:08részletek
1975iranians.huAbolfazl Ghasemi2014-11-13 19:01:08részletek
1976arbeiten.huCT Consulting Central Europe Korlátolt Felelősségű Társaság2014-11-13 19:01:08részletek
1977aranypokboltok.huTusán Ildikó Anna2014-11-13 19:01:07részletek
1978globokom.huSzerbin Éva2014-11-13 19:01:07részletek
1979hars.huUnidomain Kft.2014-11-13 19:01:07részletek
1980deryne.huKiss Péter2014-11-13 19:01:07részletek
1981uniquehungary.huUNQ Kft.2014-11-13 19:01:07részletek
1982fpvshop.huTörök Lajos2014-11-13 19:01:07részletek
19835letborze.huMolnár Levente2014-11-13 19:01:06részletek
1984start-iker.huSTART-Cseke István Autósiskola2014-11-13 19:01:06részletek
1985vajdasagi-nagycsaladosok.huMegaweb kft2014-11-13 19:01:06részletek
1986globobook.huSzerbin Éva2014-11-13 19:01:06részletek
1987ajanlolevel.huUnidomain Kft.2014-11-13 19:01:06részletek
1988worldcont.huWorldCont Kft.2014-11-13 19:01:05részletek
1989mad-xbt.humad-x bt2014-11-13 19:01:05részletek
1990argyelusneptanc.huDr. Malomsokiné Varga Nóra2014-11-13 19:01:05részletek
1991polirbeton.huWebsupport s.r.o.2014-11-13 19:01:05részletek
1992ipt.hu3Gteam Kft.2014-11-13 19:01:05részletek
1993cargomax.huAIRMAX Cargo Budapest Zrt.2014-11-13 19:01:05részletek
1994sztarcsemetetv.huBartalovics ildikó2014-11-13 19:01:04részletek
1995pyrosoft.huWebsupport s.r.o.2014-11-13 19:01:04részletek
1996qds.huSiklaky Dávid2014-11-13 19:01:04részletek
1997lbsolutions.huBalogh Csaba2014-11-13 19:01:04részletek
1998valkyrsystems.huCziráky Balázs2014-11-13 19:01:04részletek
1999naturgreen.huMizsei Berta EV.2014-11-13 19:01:04részletek
2000klima-szereles-budapest.huRutai Sándor2014-11-13 19:01:04részletek
2001studyandworktravel.huBalance Universal Kft.2014-11-13 19:01:03részletek
2002ecssz.huMegaweb kft2014-11-13 19:01:03részletek
2003idorol.huIDOROL Consulting Bt.2014-11-13 19:01:03részletek
2004csaladikornk.huMegaweb kft2014-11-13 19:01:03részletek
2005h-allvany.huStabil-Építő Kft.2014-11-13 19:01:03részletek
2006aranybolygo.huOncsik Péter2014-11-13 19:01:03részletek
2007prosody.huW3Host Bt.2014-11-13 19:01:03részletek
2008csikianyak.huMegaweb kft2014-11-13 19:01:02részletek
2009nouv.huNOUV Kft.2014-11-13 19:01:02részletek
2010wiedermannmedia.huWiedermann Károly2014-11-13 19:01:02részletek
2011youniversum.huSzerbin Éva2014-11-13 19:01:02részletek
2012peaksoft.huKatona Ádám2014-11-13 19:01:02részletek
2013bravissi.huJuhász Antal2014-11-13 19:01:01részletek
2014gnmcsinitanoda.huSwiss Beauty Fashion Kft2014-11-13 14:01:16részletek
2015szaboeditnoria.huSzabó Edit2014-11-13 14:01:16részletek
2016altx.huELIT-INFO Kft.2014-11-13 14:01:16részletek
2017fenyvesparkvaros.huAxacont Kft.2014-11-13 14:01:16részletek
2018gyerekpillanatok.huSáfrán Kornél 2014-11-13 14:01:16részletek
2019shrimpword.huTamási Rezső2014-11-13 14:01:16részletek
2020hunyadiseta.huLilihipp Bt2014-11-13 14:01:15részletek
2021simonlaci.huSimon László2014-11-13 14:01:15részletek
2022farmerbook.huHorváth Árpád2014-11-13 14:01:15részletek
2023autoszerviz-kereso.huKomplex Web+ Kft2014-11-13 14:01:15részletek
2024psa-insurance-online.huBANQUE PSA FINANCE2014-11-13 14:01:15részletek
2025bencsikattila.huDt. Bencsik Attila Lajos2014-11-13 14:01:15részletek
2026annavendeghaztarcal.huSzivós József2014-11-13 14:01:15részletek
2027privatparty.huBaranyai József2014-11-13 14:01:14részletek
2028farmerline.huHorváth Árpád2014-11-13 14:01:14részletek
2029alt-x.huELIT-INFO Kft.2014-11-13 14:01:14részletek
2030webedu.huTömöry Ákos2014-11-13 14:01:14részletek
2031hazaibio.huFair Solutions Kft2014-11-13 14:01:14részletek
2032munkavedelmi-webaruhaz.huKotreba Viktor2014-11-13 14:01:14részletek
2033modernrobinson.huWebsupport s.r.o.2014-11-13 14:01:14részletek
2034a-plusz.huKurucz Regina2014-11-13 14:01:14részletek
2035geregreta.huGere Gréta2014-11-13 14:01:14részletek
2036albertnedrboda.huAlbertné dr. Boda Zsuzsanna2014-11-13 14:01:13részletek
2037csudabogar.huSub Stúdió Kft.2014-11-13 14:01:13részletek
2038thefashionmarket.huFashion Market Kft.2014-11-13 14:01:13részletek
2039dndstorages.huDnD Coin-Tech Kft2014-11-13 14:01:13részletek
2040pwhost.huIfj. Meskó Gábor2014-11-13 14:01:13részletek
2041parcsamisirko.huParcsami Miklós2014-11-13 14:01:13részletek
2042cserepfolde.huJakab-Bor Ildikó2014-11-13 14:01:13részletek
2043mjam.huGastro-Web Kft.2014-11-13 14:01:12részletek
2044extrauzlet.huNyomell Kft.2014-11-13 14:01:12részletek
2045grafologiastudio.huMikecz Zsolt2014-11-13 14:01:12részletek
2046csokiexpressz.huMalibo Kft.2014-11-13 14:01:12részletek
2047malibo.huMalibo Kft.2014-11-13 14:01:12részletek
2048olivinperidot.huOlivinPeridot Kft.2014-11-13 14:01:12részletek
2049chatbox.huSzilágyi Róbert2014-11-13 14:01:12részletek
2050ászbazár.huTóth Róbert2014-11-13 14:01:12részletek
2051szgyfzala.huSzociális és Gyermekvédelmi Főigazgatóság2014-11-13 14:01:11részletek
2052lionduino.huMarozs Balázs2014-11-13 14:01:11részletek
2053tapetaakcio.huÍrisz-Dekor Kft2014-11-13 14:01:11részletek
2054goextra.huWebmédia Market Kft.2014-11-13 14:01:11részletek
2055vollmersolar.huVollmer Alumínium Hungária Épületburkolatok Kft.2014-11-13 14:01:11részletek
2056botkatrans.huLévai Balázs2014-11-13 14:01:11részletek
2057sörfőzés.huOlcsváry Gyula2014-11-13 14:01:11részletek
2058budaimuvek.huBudai Oszkár e.v.2014-11-13 14:01:10részletek
2059budaitanacsado.huDr Karner Orsolya2014-11-13 14:01:10részletek
2060budaitanacsadas.huDr Karner Orsolya2014-11-13 14:01:10részletek
2061freefm.huMolnár Bálint2014-11-13 14:01:10részletek
2062hirosfoldmero.huDiamond Bridge Hungary Kft2014-11-13 14:01:10részletek
2063hirdb.huCsordás Zoltán2014-11-13 14:01:10részletek
2064montinvent.huMontinvent Kft.2014-11-13 14:01:10részletek
2065silectarto.huRetroad Kft.2014-11-13 14:01:10részletek
2066ingema.huWebsupport s.r.o.2014-11-13 14:01:09részletek
2067leddeal.huHorváth Judit e.v.2014-11-13 14:01:09részletek
2068kulfoldifeherborok.huBBest.co.hu Kft.2014-11-13 14:01:09részletek
2069kulfoldivorosborok.huBBest.co.hu Kft.2014-11-13 14:01:09részletek
2070geodatastore.huK_CORP s.r.o.2014-11-13 14:01:09részletek
2071tiszafeszt.huHírös Városunk és Térségének Hagyományaiért Alapítvány2014-11-13 14:01:09részletek
2072tile.huVeress Gyula2014-11-13 14:01:09részletek
2073i-társ.huHostmasters Internet Services Hungary Kft. (Registrar)2014-11-13 14:01:08részletek
2074classhazak.huClassHázak Kft.2014-11-13 14:01:08részletek
2075wawstudio.huFarkas Kálmán Csaba2014-11-13 14:01:08részletek
2076szantogerda.huSzántó Gerda2014-11-13 14:01:08részletek
2077led-deal.huHorváth Judit e.v.2014-11-13 14:01:08részletek
2078superled.huHorváth Judit e.v.2014-11-13 14:01:08részletek
2079viragkuldesolcson.huVirág Varázs 56. ker. és szolg. Bt.2014-11-13 14:01:08részletek
2080vargarden.huVarga Sándor2014-11-13 14:01:08részletek
2081tiszatajkozalapitvany.huTiszatáj Környezet - és Természetvédelmi Közalapítvány2014-11-13 14:01:07részletek
2082faludig-ekszer.huGenius Marketing Management Kft2014-11-13 14:01:07részletek
2083webhaztartas.huCountrynet Szociális Szövetkezet2014-11-13 14:01:07részletek
2084airbusds.huAirbus DS Geo Hungary Kft.2014-11-13 14:01:07részletek
2085elitestudio.huLeisure Master Kft2014-11-13 14:01:07részletek
2086gitarvideo.huSzánkovics Ferenc2014-11-13 14:01:07részletek
2087kidsoasisklub.huKidsoasis Kft.2014-11-13 14:01:07részletek
2088talizz.huJuhász Sándor2014-11-13 14:01:06részletek
2089beliefstore.huApáti Ákos2014-11-13 14:01:06részletek
2090crowbeer.huAnro Tata Bt2014-11-13 14:01:06részletek
2091ir-dieta.huTörök Eszter Anikó2014-11-13 14:01:06részletek
2092uzletnet.huNyomell Kft.2014-11-13 14:01:06részletek
2093pizzatanya.huBozsó Tamás2014-11-13 14:01:06részletek
2094jm-design.huJarmaczki Márk2014-11-13 14:01:06részletek
2095clewear.huWebsupport s.r.o.2014-11-13 14:01:05részletek
2096partystudio.huKeszei László2014-11-13 14:01:05részletek
2097kovagoep.huSio Rally Kft2014-11-13 14:01:05részletek
2098sorexcsoport.huSorex Csoport Kft.2014-11-13 14:01:05részletek
2099csaladbarat-szallashelyek.huKidsoasis Kft.2014-11-13 14:01:05részletek
2100abw-iroda.huKinnarps Hungary Kft.2014-11-13 14:01:05részletek
2101bondcare.huWebsupport s.r.o.2014-11-13 14:01:04részletek
2102clscargo.huNoname Domain Kft.2014-11-13 14:01:04részletek
2103arcaffe.co.huArcaffé Estero Srl2014-11-13 14:01:04részletek
2104onballs.huBarcza-Hidas László2014-11-13 14:01:04részletek
2105dolgozzmaskepp.huKinnarps Hungary Kft.2014-11-13 14:01:04részletek
2106nextoffice-abw.huKinnarps Hungary Kft.2014-11-13 14:01:04részletek
2107abwiroda.huKinnarps Hungary Kft.2014-11-13 14:01:04részletek
2108csinitanoda.huSwiss Beauty Fashion Kft2014-11-13 14:01:03részletek
2109multiservices.huEuroDNS S.A.2014-11-13 14:01:03részletek
2110vixihirek.huEHGS GROPUP Bt.2014-11-13 14:01:03részletek
2111fenntarthatosagert.huF6 Fenntarthatóságért Egyesület2014-11-13 14:01:03részletek
2112arato2001kft.huArató 2001 Kft.2014-11-13 14:01:03részletek
2113a3d.huM CITY Kft.2014-11-13 14:01:03részletek
2114szelfibot.huTomanovics Gergely2014-11-13 14:01:03részletek
2115elitstudio.huLeisure Master Kft2014-11-13 14:01:02részletek
2116koltoztetes-frankoteher.huFranko Teher Kft.2014-11-13 14:01:02részletek
2117feherpoker.huPoker White Kft2014-11-13 14:01:02részletek
2118dekorcrew.huDEKOR-CREW Bt.2014-11-13 14:01:02részletek
2119akasagarbha.huDebrei Helga2014-11-13 14:01:02részletek
2120arato2001.huArató 2001 Kft.2014-11-13 14:01:02részletek
2121matraiszallasok.huE-Komfort Kft.2014-11-13 14:01:02részletek
2122triaxmultimedia.huTriax A/S2014-11-13 14:01:01részletek
2123auchandirect.huFortax Kft.2014-11-12 14:01:29részletek
2124milwaukeeszerszam.huDL'1 Villamossági Nagykereskedés Kft2014-11-12 14:01:17részletek
2125auchandirekt.huFortax Kft.2014-11-12 14:01:16részletek
2126grundigshop.huBreyer Balázs2014-11-11 19:01:12részletek
2127lyngsat.huEuroCable Magyarorszag Kft.2014-11-10 14:02:10részletek
2128lego-webshop.huWebMeszler Kft.2014-11-10 14:01:59részletek
2129telekomwebshop.huDutel Kft. 2014-11-10 14:01:23részletek
2130fogas.huKiss Péter2014-11-10 14:01:12részletek
Főlap | Regisztrátorok listája | Delegálási szabályok | Meghirdetés | Keresés | Technikai ellenőrzés
Tanácsadó testület | Alternatív vitarendezés | Eseti Választottbíróság | Archívum | Egyebek | Statisztika