Meghirdetés - ABC szerint sorbarendezett lista

Utolsó módosítás: 2014-11-23 17:35:01

SorszámDomain neveIgénylőBejegyzett feltételes használat kezdeteRészletek
10-24-nyomda.huPrádel Zsolt2014-11-21 19:01:04részletek
20-crypt.huINTEGRITY Kft.2014-11-21 14:01:27részletek
30crypt.huINTEGRITY Kft.2014-11-21 14:01:24részletek
410en.huEuroCable Magyarorszag Kft.2014-11-19 14:01:07részletek
511web.huDanyi László2014-11-19 19:01:20részletek
61861pecs.huUpsolution Kft.2014-11-17 14:01:15részletek
71domain.huBártfai Balázs2014-11-18 14:01:05részletek
8212.huMarketingHelp Kft.2014-11-21 14:01:08részletek
9212km.huMarketingHelp Kft.2014-11-21 14:01:08részletek
102box.huMindOn Solutions Kft.2014-11-19 14:01:04részletek
112juhasz.huJuhász Tamás2014-11-17 19:01:13részletek
122zsiraf.huKrix Zoltán2014-11-19 19:01:07részletek
13321car.huHofer Sándor2014-11-19 14:01:14részletek
14365suti.huWe are design Kft.2014-11-20 19:01:19részletek
153d-fal.huGila Ádám2014-11-17 14:01:15részletek
163mango.huTóth Attila2014-11-17 14:01:13részletek
174kstudio.huMedgyesi Zoltán2014-11-22 23:01:02részletek
185starpizza.huMoles Béla E.V.2014-11-21 19:01:12részletek
19619media.huLückl Roland2014-11-18 19:01:07részletek
2067p.huPohl Veronika2014-11-17 19:01:20részletek
21a-part-man.huDél-Alföldi Turisztikai és Idegenforgalmi Szociális Szövetkezet2014-11-20 19:01:07részletek
22a-szalon.huUdvardi Péter2014-11-20 19:01:08részletek
23a01.huKrix Zoltán2014-11-19 19:01:12részletek
24aaaa.huGéczi János2014-11-18 14:01:08részletek
25abasarioltvany.huAbasár Község Önkormányzata2014-11-19 19:01:20részletek
26abasariterko.huAbasári Nonprofit Településüzemeltetési és Fejlesztési Kft. 2014-11-19 19:01:20részletek
27abde.huAlföld-Budapest-Dunántúl Felnőttképzési és Humánszolgáltató Egyesülés2014-11-19 23:01:10részletek
28acci.huZ-Terv Stúdió Kft.2014-11-18 23:01:18részletek
29accountspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
30aceremoniakmestere.huKiss Dániel2014-11-19 19:01:21részletek
31aceremoniakmesterei.huKiss Dániel2014-11-19 19:01:11részletek
32acrysoftrestor.huMarkMonitor International Ltd.2014-11-17 19:01:04részletek
33adamklinika.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:15részletek
34adamsegedeszkoz.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:23részletek
35adotanacsadoszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
36adplanee.huSenpai Consulting Kft. 2014-11-21 14:01:23részletek
37adsolute.huWebsupport s.r.o.2014-11-20 14:01:12részletek
38adventbécs.huTóth Éva2014-11-17 14:01:23részletek
39aeek.huUniweb Plusz Kft2014-11-20 19:01:06részletek
40aerosus.huEuro-Trans Hungary Kft.2014-11-16 19:01:05részletek
41agileeconomy.huXerox Magyarország Kft.2014-11-21 14:01:25részletek
42agoratermeloipiac.huAgora a Termelők Piacáért Egyesület2014-11-18 23:01:04részletek
43agostonalapitvany.huÁgoston Sándor Alapítvány2014-11-18 14:01:04részletek
44agyhatalom.huTúri Lajos2014-11-17 19:01:02részletek
45agyhuzat.huSteiner Hajnal2014-11-21 14:01:29részletek
46agymozi.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
47airacademy.huWebenlét Kft.2014-11-18 19:01:04részletek
48ajandekba.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
49ajandeknyomda.huGurmai Sándor 2014-11-17 19:01:22részletek
50ajandekoznijo.huPárta Péter2014-11-17 14:01:03részletek
51ajkarockband.huKrix Zoltán2014-11-20 14:01:12részletek
52ajto-kilincs.huB&M Mechanika Kft.2014-11-17 19:01:04részletek
53ajtoablakaruhaz.huMOBILPARTNER HUNGARY Kft.2014-11-21 19:01:10részletek
54akciohazhozmegy.huD-Com Group Kft.2014-11-21 14:01:09részletek
55akciok-blackfriday.huMINDEKA IT SRL2014-11-21 19:01:14részletek
56akciok-kedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:06részletek
57akciokkedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:05részletek
58akkuhazhoz.huFöldesi Zsolt2014-11-16 19:01:07részletek
59akkuport.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
60akkuzona.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
61aktivsportok.huSWA Szervíz Kft2014-11-17 19:01:14részletek
62alacream.huWestsidecafe Creative Kft.2014-11-21 19:01:03részletek
63aladdingsm.huTÁM-FAL 2000. Kereskedelmi, Ipari és Szolgáltató Bt.2014-11-21 14:01:15részletek
64alakformaloharisnya.huÖko-PC Kft.2014-11-21 19:01:16részletek
65alefgaszt.huAlefgaszt Kft.2014-11-17 19:01:13részletek
66alizium.huNagy-Kollár Alíz2014-11-17 19:01:09részletek
67alkalmi-buvohelybuda.huPécsvári Richárd2014-11-18 14:01:13részletek
68alkus.huMeva Zsalurendszerek Zrt.2014-11-20 14:01:13részletek
69allatbutor.huVágner Adrienn2014-11-18 14:01:09részletek
70allattartovagyok.hu4SZS Kft.2014-11-18 23:01:14részletek
71alloasztal.huNowart Bt.2014-11-21 19:01:02részletek
72almamania.huKrix Zoltán2014-11-19 19:01:14részletek
73almaregio.huEast-Gate Bt2014-11-21 23:01:02részletek
74almerabonto.huDemmel László2014-11-19 23:01:06részletek
75almresort-gerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:14részletek
76almresortgerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:12részletek
77alomgardrob.huKoch-Babics Éva2014-11-18 23:01:10részletek
78alphaharmony.huGaál Béla2014-11-15 14:01:03részletek
79alsoorsiplebania.huAlsóörs Római Katolikus Plébánia2014-11-20 14:01:09részletek
80altershop.huVincze Dávid2014-11-19 19:01:17részletek
81alufeny.huB&M Mechanika Kft.2014-11-17 19:01:05részletek
82amarodrom.huIntronet Szoftverfejlesztő és Informatikai Kft.2014-11-21 19:01:07részletek
83amatorsulyemeles.huWalcz Krisztián2014-11-21 14:01:19részletek
84amatőr-szex.huDiczkó Csaba2014-11-20 19:01:06részletek
85ambulanciaspolo.huAmbulance Medical Kft.2014-11-18 23:01:13részletek
86ambupolo.huAmbulance Medical Kft.2014-11-18 23:01:11részletek
87ameddosegellen.huSzmola Erika2014-11-19 14:01:13részletek
88amedical.huAmbulance Medical Kft.2014-11-18 23:01:10részletek
89amegoldas.konyvelo.huA MEGOLDÁS Könyvelő Kft.2014-11-17 14:01:24részletek
90amitarsashazunk.huLivingstones Hungary Kft.2014-11-17 23:01:02részletek
91anapitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
92anál.huDiczkó Csaba2014-11-21 14:01:22részletek
93androidpenztargep.huNazza Software Kft.2014-11-20 14:01:13részletek
94angyaliajandek.huTóthné Szabó Andrea2014-11-21 19:01:20részletek
95angyalkertkisvarda.huSzent György Görögkatolikus Óvoda és Általános Iskola 2014-11-21 14:01:18részletek
96anikodxn.huFaragó Anikó2014-11-17 19:01:09részletek
97animaljam.co.huWebenlét Kft.2014-11-16 19:01:04részletek
98animaljam.huWebenlét Kft.2014-11-16 19:01:04részletek
99annadesign.huPataki Annamária2014-11-18 23:01:20részletek
100anne-webshop.huMódium Divatház Kft.2014-11-21 19:01:13részletek
101anovenydoki.huUjvári Péter2014-11-20 19:01:21részletek
102antiokostelefon.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
103antismartphone.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
104anyagtudomanykft.huAnyagtudomány Kutató, Fejlesztő és Szolgáltató Kft.2014-11-21 19:01:15részletek
105anyalelek.huDénes Margit2014-11-18 14:01:03részletek
106anzix-art.huDeák-Fogarasi István2014-11-19 14:01:04részletek
107apartmango.huIstvándi János2014-11-19 14:01:05részletek
108apay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
109aqua-ponia.huCsiba Gergely2014-11-19 14:01:20részletek
110aquaponic-system.huCsiba Gergely2014-11-19 14:01:20részletek
111aquaponic.huCsiba Gergely2014-11-19 14:01:02részletek
112aquaponics-system.huCsiba Gergely2014-11-19 14:01:19részletek
113aquastic.huWebsupport s.r.o.2014-11-18 14:01:29részletek
114aranea.huSüleweb Kft.2014-11-21 14:01:10részletek
115araneaengine.huSüleweb Kft.2014-11-21 14:01:10részletek
116aranyeda.huKoncz Edit2014-11-20 19:01:09részletek
117aranyer-ambulancia.huMDC Medical Group Kft.2014-11-21 14:01:11részletek
118aranyerambulancia.huMDC Medical Group Kft.2014-11-21 14:01:06részletek
119aranypart.huCetinje s.r.o.2014-11-19 19:01:01részletek
120arkenstonemainecoon.huNagy Éva2014-11-18 23:01:03részletek
121arnytechnika.huMimas System Kft2014-11-20 14:01:09részletek
122aroma-one.huAtlantis Systems, s.r.o.2014-11-19 23:01:11részletek
123aromaone.huAtlantis Systems, s.r.o.2014-11-19 23:01:10részletek
124artandcraft.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:25részletek
125artisteer.huKollár-Ker Kft.2014-11-22 23:01:02részletek
126artmta.huSzilágyi Sándor2014-11-21 14:01:05részletek
127aru24.huHencz Imre e.v.2014-11-17 14:01:09részletek
128aspentravel.huKrix Zoltán2014-11-19 19:01:08részletek
129aszemelyisoforod.huSzmola Erika2014-11-19 14:01:16részletek
130aszesz2003kft.huÁSZ-ÉSZ 2003 Gazdasági Szolgáltató és Építészeti Kft2014-11-19 14:01:10részletek
131asztalos-keszthely.huBIOFA-GYENES Kft2014-11-18 23:01:17részletek
132asztalosattila.huDr. Asztalos Attila2014-11-17 14:01:21részletek
133asztrologia24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
134at-kft.huEgyütt Egymásért Arthur Troop Nonprofit Kft.2014-11-21 14:01:25részletek
135atac.huATAC Informatikai, Kereskedelmi és Szolgáltató Kft.2014-11-20 19:01:08részletek
136atecuccod.huAkrouf Design Kft2014-11-19 19:01:13részletek
137atrainer.huTóth Alexandra2014-11-17 19:01:05részletek
138atrinova.huDespa Trust Kft.2014-11-18 23:01:12részletek
139atriumfoto.huDudásné Kovács Renáta EV2014-11-21 14:01:19részletek
140attilavill.huATTILAVILL Kft.2014-11-18 14:01:07részletek
141attractivcenter.huEuroDNS S.A.2014-11-17 14:01:04részletek
142auchandirect.huFortax Kft.2014-11-12 14:01:29részletek
143auchandirekt.huFortax Kft.2014-11-12 14:01:16részletek
144autogumi24net.huminden24 Információ Kft2014-11-18 23:01:15részletek
145autojaertkeszpenzazonnal.huA111 Autó Kft.2014-11-18 23:01:15részletek
146autojot.huOzsváth János2014-11-18 23:01:15részletek
147autoplusz.huEuroDNS S.A.2014-11-17 14:01:16részletek
148autoszervizpenztargep.huNazza Software Kft.2014-11-17 19:01:19részletek
149azeskuvo.huNagy Gergely Csaba2014-11-21 14:01:09részletek
150azeskuvonk.huBalajti István2014-11-17 14:01:04részletek
151azsiailanyok.huDiczkó Csaba2014-11-20 14:01:11részletek
152azzurracouture.huLuxuria Moda Kft2014-11-19 23:01:12részletek
153átvételi-pont.huManda Kft.2014-11-18 14:01:01részletek
154b-g.huNémeth Lajos2014-11-18 19:01:06részletek
155b-intense.huB-intense GmbH Als Zweigniederlassung Der CB-Capital GmbH2014-11-17 23:01:01részletek
156bababiznisz.huZaláné Csörsz Eszter2014-11-21 14:01:06részletek
157babauszas.co.huLonkai Adrienn2014-11-20 19:01:06részletek
158babeldelicate.huKrix Zoltán2014-11-19 19:01:14részletek
159babydesign.huDevron-Impex Kft2014-11-19 14:01:18részletek
160bachcseppek.huÉden-Esszencia Kft2014-11-18 23:01:23részletek
161bacsa-konyvelokft.huBacsa-Könyvelő Kft.2014-11-18 23:01:11részletek
162bacska-online.huKecskés Zsolt2014-11-17 19:01:07részletek
163bakeshop.huKurai Péter2014-11-21 14:01:17részletek
164balaton-tv.huVeresegyházi Városi Televízió Kft.2014-11-17 19:01:05részletek
165balatonfeinkost.huBalatonFeinkost Kft.2014-11-21 14:01:11részletek
166balatontickets.huTktStaff Kft.2014-11-17 14:01:11részletek
167balazska.huFöldházi Balázs2014-11-19 14:01:06részletek
168bandart.huGalaktika Szakkör Bt.2014-11-21 14:01:10részletek
169barbara.co.huMark Marketing Kft.2014-11-17 14:01:16részletek
170barbikuckoja.huBoda Barbara2014-11-21 19:01:04részletek
171baromfitragya.huTóth Attila2014-11-19 14:01:06részletek
172bartime.huNehmar Yacine2014-11-18 14:01:24részletek
173batyifc.huGombás Péter2014-11-20 14:01:15részletek
174baxalta.co.huBaxter Healthcare Corporation2014-11-19 23:01:02részletek
175baxalta.huCorporation Service Company (UK) Limited 2014-11-19 14:01:12részletek
176bbbau.huKovács Attila2014-11-18 14:01:11részletek
177bbpragmatic.huBagyánszky Zoltán Márió2014-11-20 19:01:12részletek
178bcfxbroker.huRozgonyi György2014-11-20 19:01:21részletek
179beanlight.hu Discovery Bliss Kft.2014-11-17 19:01:20részletek
180beautypoint.huKeresztesi Ildikó2014-11-21 19:01:19részletek
181bedcinema.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
182beeboo.huTanyik Adrienn2014-11-19 19:01:15részletek
183behopp.huTokai Sándor e.v.2014-11-21 14:01:05részletek
184bekesijarasok.huMCOnet International Kft.2014-11-18 14:01:04részletek
185belkinsupport.huFarago Sandor2014-11-17 14:01:08részletek
186bellozzo.huFusion Befektetési Zrt.2014-11-20 19:01:01részletek
187belsoepiteszstudio.huIDM Group Kft. 2014-11-17 19:01:01részletek
188beltekcoop.huBéltek Coop Zrt.2014-11-18 14:01:17részletek
189bencecoach.huNoname Domain Kft.2014-11-16 19:01:03részletek
190berczy.huBérczy Gergely2014-11-17 14:01:04részletek
191bernover.huAmbulance Medical Kft.2014-11-18 23:01:14részletek
192bestclean.huHussein Zoltán2014-11-18 14:01:03részletek
193bestdivingplaces.huKrix Zoltánné2014-11-18 14:01:10részletek
194bestgoulash.huAgrocorp Consulting Kft2014-11-21 14:01:01részletek
195beugrok.huSZIGETKÖZ.NET Kft.2014-11-19 19:01:10részletek
196bécs.huTóth Éva2014-11-18 19:01:07részletek
197bfb.co.huB.F.B. CONSULTING Kft.2014-11-17 19:01:15részletek
198bfn.huBloom Fashion Group Kft.2014-11-18 14:01:30részletek
199bigbuy.huBichis János2014-11-18 19:01:01részletek
200bigdog.huPintyéné Deák Anita2014-11-19 19:01:03részletek
201billpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
202bimmermaster.huLovas Gergely2014-11-15 14:01:02részletek
203biofa-gyenes.huBIOFA-GYENES Kft2014-11-18 23:01:14részletek
204bionikusalapitvany.huSzűcs László2014-11-17 14:01:02részletek
205biorezo.huLadányi Zsuzsanna2014-11-20 14:01:07részletek
206biotea.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
207bistromandarin.huGBaRT Design Stúdió Kft.2014-11-18 14:01:11részletek
208bitsector.huWebon Consulting Kft.2014-11-18 14:01:11részletek
209biztonsagmuhely.huBiztonság Műhely Szolgáltató Szociális Szövetkezet2014-11-17 19:01:06részletek
210biztositas24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
211blackcode.huVerhás Dániel2014-11-19 19:01:16részletek
212blackdiamondportfolio.huGold Trader & Co. Befektetési Ügynökség Kft.2014-11-19 14:01:03részletek
213blackfridays.huNoname Domain Kft.2014-11-20 14:01:12részletek
214blankart.huSimon Levente2014-11-18 14:01:12részletek
215blog-probiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
216blogprobiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
217bminfo.hueCapital.hu Kft.2014-11-20 19:01:17részletek
218bocskaigimnazium.hu Bocskai István Alapitvány2014-11-17 14:01:10részletek
219bodzsi.huHorváthné Bodzsár Szilvia 2014-11-20 19:01:15részletek
220bolho.huBolhó Község Önkormányzata2014-11-18 23:01:08részletek
221bontottarbanujalkatresz.huSH Group Kft.2014-11-19 19:01:17részletek
222bonzo.huEuroCable Magyarorszag Kft.2014-11-17 14:01:24részletek
223borealattispenzvan.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
224boritekolas.huBártfai Balázs2014-11-20 14:01:05részletek
225borsabrown.huPublish and More Kft.2014-11-18 19:01:03részletek
226borsokaland.huGulyás júlia2014-11-18 14:01:28részletek
227borthordok.huPulispace Fejlesztő és Szolgáltató Kft.2014-11-21 19:01:11részletek
228borwebaruhaz.huNet-Tech Consulting Kft.2014-11-17 14:01:01részletek
229boxbufe.huAFIS Kft.2014-11-20 14:01:01részletek
230bptech.huMilassin András2014-11-20 14:01:15részletek
231brandandtrend.hu CIPŐGURU KFT.2014-11-17 23:01:01részletek
232brandfriends.huTóth Balázs2014-11-18 23:01:08részletek
233brankoholding.huBranko Holding Zrt.2014-11-21 19:01:06részletek
234brickleberry.huNoname Domain Kft.2014-11-16 19:01:06részletek
235brikettgyar.huBrikettpont Kft.2014-11-19 19:01:16részletek
236bringacentrum.huKercom Kft2014-11-18 19:01:07részletek
237bsbnetwork.huBalogh Sándor2014-11-17 14:01:06részletek
238bububababolt.hu Kígyós Ferenc2014-11-17 14:01:23részletek
239budaiborbely.huBARBER ART KFT2014-11-21 19:01:04részletek
240budaiborszalon.huKrix Zoltán2014-11-19 19:01:08részletek
241budakeszikonyvelo.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:05részletek
242budakeszikonyveloiroda.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:09részletek
243budapestartweekend.huBérczi Linda2014-11-19 14:01:11részletek
244budapestfashionnight.huBloom Fashion Group Kft.2014-11-18 14:01:10részletek
245budapestgoulash.huAgrocorp Consulting Kft2014-11-21 14:01:07részletek
246budapesthelicopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
247budapesthelikopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
248budapestickets.huTktStaff Kft.2014-11-17 14:01:12részletek
249budapestiugyvediiroda.huDr. Fórizs Zsolt 2014-11-20 19:01:02részletek
250budapestkutyakozmetika.huWinkler Judit2014-11-18 14:01:05részletek
251budapestriksa.huSzőke Tibor2014-11-21 19:01:05részletek
252budapestwiengid.huHorváth Dóra2014-11-17 14:01:18részletek
253budavara.huTredit-SOL Kft.2014-11-18 23:01:07részletek
254bujinkanbudapest.huEuroDNS S.A.2014-11-17 14:01:16részletek
255burgpalast.huTredit-SOL Kft.2014-11-18 23:01:05részletek
256butorbolt-cegled.huRutai Sándor2014-11-20 19:01:07részletek
257butorkapu.huKorcsok Sándor2014-11-21 19:01:06részletek
258butorszerelok.huKrix Zoltán2014-11-19 19:01:11részletek
259buvohelybuda.info.huPécsvári Richárd2014-11-18 14:01:22részletek
260buvohelybudaors.huPécsvári Richárd2014-11-18 14:01:13részletek
261buyandsale.huGEO-13 KFT.2014-11-21 14:01:22részletek
262bvda.huTredit-SOL Kft.2014-11-18 23:01:06részletek
263calibrapet.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:21részletek
264calibratap.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:19részletek
265cammogo.huCreateam Reklámügynökség Kft2014-11-20 19:01:02részletek
266cardless.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
267cardlesspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
268carlock.huCyclick Kft.2014-11-19 23:01:02részletek
269casiokarora.huKöles Antal2014-11-21 19:01:10részletek
270casioora.huKöles Antal2014-11-21 19:01:19részletek
271cedrusudvar.huCodemakers Kft2014-11-19 23:01:07részletek
272cegledpartner.huKonrext Kft.2014-11-19 19:01:01részletek
273cegnevsor.huBártfai Balázs2014-11-20 19:01:05részletek
274cekka.huHorváthné Kiss Claudia EV2014-11-18 14:01:09részletek
275celeris.huUnidomain Kft.2014-11-19 19:01:06részletek
276centrumrentacar.huBajcsi Illés Antalné2014-11-21 14:01:15részletek
277ceremoniakmestere.huKiss Dániel2014-11-19 14:01:16részletek
278ceremoniakmesterei.huKiss Dániel2014-11-19 14:01:17részletek
279chatvonal.huConPhone Audio Conferening Kft.2014-11-18 14:01:10részletek
280chetrin.huCHETRIN Szociális Szövetkezet2014-11-18 14:01:15részletek
281chezdodo.huMacaron és társai Kft.2014-11-17 14:01:09részletek
282chilitec.huArtSoft Hungary Kft.2014-11-17 14:01:11részletek
283chipolino.huDevron-Impex Kft2014-11-19 14:01:18részletek
284chop.huKovács Balázs2014-11-17 14:01:13részletek
285cicasitter.huHavasvölgyi Csilla2014-11-21 19:01:19részletek
286cilter.huCyclick Kft.2014-11-19 23:01:02részletek
287cityeuro.huKántor László2014-11-21 14:01:07részletek
288cityflatoperator.huVárhelyi Bence2014-11-21 19:01:08részletek
289citygardens.huE-Building kft 2014-11-19 14:01:06részletek
290classhostess.huFülöpp Péter2014-11-18 14:01:29részletek
291classmodell.huFülöpp Péter2014-11-18 14:01:30részletek
292clearplanet.huClear Planet Zrt.2014-11-19 14:01:08részletek
293cleverframe.huLeme Kft2014-11-19 14:01:17részletek
294clickbox.huSwift Technologies Kft.2014-11-20 19:01:22részletek
295clickcenter.huCzézár Csanád2014-11-21 14:01:23részletek
296clickport.huMalindovszky Tamás2014-11-21 19:01:04részletek
297clublondon.huT.A.E.V. Kft.2014-11-21 14:01:04részletek
298cocktailforever.huBencsik Szilveszter2014-11-19 23:01:08részletek
299coinpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
300colorpor.huEuroDNS S.A.2014-11-17 14:01:16részletek
301computerpanorama.huKrix Zoltán2014-11-19 19:01:11részletek
302conphone.huConPhone Audio Conferening Kft.2014-11-19 19:01:05részletek
303conteharisnya.huÖko-PC Kft.2014-11-21 19:01:14részletek
304controlsys.huCONTROSYS Irányítástechnikai Kft.2014-11-21 14:01:19részletek
305coolmovie.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
306cpptrade.hu Leidgeb Dániel2014-11-17 14:01:05részletek
307creativejob.co.huFarkasfalvi Balázs2014-11-19 14:01:08részletek
308creatiw.huLuremta Ker. Kft.2014-11-18 14:01:29részletek
309creditpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
310crystalszepsegszalon.hu6 sz. 2010. Kft.2014-11-18 23:01:01részletek
311csabapolo.huCsabai Csirkefogók Vizilabda Klub2014-11-17 14:01:13részletek
312csakajokmennekel.huClassik Marketing Kft.2014-11-20 19:01:10részletek
313csakany-es-penna-kovycs59.huKovács László2014-11-18 14:01:27részletek
314csakazene.huVarga Sándor E. V.2014-11-18 19:01:06részletek
315csaladikonfliktusok.huAranyos Zsolt2014-11-20 19:01:21részletek
316csaladjogpecs.huDr. Valler Zsuzsa2014-11-21 14:01:16részletek
317csatlakoznek.huLak Antal2014-11-21 19:01:14részletek
318csavarplusz.huHajas Gábor Péter2014-11-19 14:01:08részletek
319csavartrade.huVass István2014-11-19 14:01:18részletek
320csempe-furdoszoba.huVarga Tamás2014-11-17 14:01:21részletek
321csendtest.huMarkovich Zsigmond2014-11-21 14:01:30részletek
322cseporke.huVarga Tamás2014-11-21 19:01:07részletek
323cserkoakku.huCserné Radonics Piroska2014-11-19 19:01:03részletek
324csigakrem.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
325csigakrém.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
326csikosfuzet.huKarpf Sándor2014-11-21 23:01:03részletek
327csikotuzhely.huPorgesz Gábor2014-11-18 14:01:15részletek
328csillagda.huKrix Zoltánné2014-11-17 14:01:02részletek
329csillagokhaboruja.huSimon Zoltán2014-11-18 14:01:30részletek
330csipetnyidesign.huVisztricz Petra2014-11-19 19:01:15részletek
331csipteto.huGravitas B.V.Á. Kft.2014-11-21 23:01:02részletek
332csizmadiakftpapa.huCsizmadia és Társai Kft.2014-11-20 14:01:09részletek
333csmix.huEcsedi Ádám2014-11-17 19:01:10részletek
334csokifalat.huBor Panna2014-11-18 14:01:28részletek
335csudarumli.huBencsik Szilveszter2014-11-19 14:01:11részletek
336csupaszmacska.huNagy-Ördög Csilla2014-11-19 23:01:11részletek
337cszsgt.huBársony László2014-11-17 19:01:03részletek
338cuponation.huPiquerez Nicolas2014-11-17 19:01:09részletek
339cybertek.huKeeNet Kft.2014-11-21 14:01:02részletek
340dalakedvesnek.huALTAweb Kft.2014-11-20 19:01:20részletek
341dantian.huFortis Solutio Kft.2014-11-18 14:01:25részletek
342danubelkwstore.huZsámbok János2014-11-20 19:01:08részletek
343danubewedding.huVarga-Kovács Tímea2014-11-20 19:01:19részletek
344darlingdekor.huKökényesi Ferenc Dániel2014-11-20 19:01:14részletek
345darwin-tol-istenig.huAnonymouse Domains s.r.o.2014-11-19 19:01:22részletek
346datacontrol.huUnidomain Kft.2014-11-19 19:01:04részletek
347db-system.huWebenlét Kft.2014-11-16 19:01:04részletek
348dcfxbroker.huRozgonyi György2014-11-20 19:01:09részletek
349de24.huBencsik Szilveszter2014-11-19 14:01:14részletek
350deathfellows.huKrix Zoltán2014-11-19 19:01:08részletek
351deb-habszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:14részletek
352deb-szappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
353debhabszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
354debrecentv.huRaycom-GTE Kft2014-11-14 19:01:01részletek
355debszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:09részletek
356decofriendly.huSajgó Anikó Józsa2014-11-21 23:01:02részletek
357defibrillatorplus.huVarga Erika2014-11-17 19:01:03részletek
358defibrillatorplusz.huVarga Erika2014-11-17 19:01:04részletek
359dekanter.huKenyeres Mónika2014-11-19 23:01:12részletek
360delelopince.huBusiness Innovant Kft.2014-11-18 14:01:22részletek
361delelőpince.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
362delfinkonyvek.huMaxim Könyvkiadó Kft.2014-11-20 19:01:03részletek
363delkim.huHalász László2014-11-17 19:01:12részletek
364demeterkis.huDemeter Róbert2014-11-16 19:01:03részletek
365demir.huBakóczy Zoltán2014-11-17 14:01:08részletek
366demokratikusminimum.huHraskó Gábor Tamás2014-11-19 14:01:13részletek
367dentocal.huDr. Antolik Marianna2014-11-21 19:01:20részletek
368dentsanaheviz.huVass Gyula Istvan2014-11-16 19:01:06részletek
369depostone.huFarkas Gyula2014-11-18 14:01:21részletek
370design4-u.huMészáros Dóra2014-11-18 14:01:11részletek
371designdistrict.huKrix Zoltán2014-11-19 19:01:13részletek
372designmadeinhungary.huSimon Péter2014-11-17 19:01:19részletek
373devizatanfolyam.huSolidusfx Trading Kft.2014-11-19 14:01:13részletek
374devsociety.huProject029 Media and Communications Kft.2014-11-18 23:01:24részletek
375diamond-lift.huSipos László2014-11-19 14:01:21részletek
376diamondcosmetics.huNail Shop Bt.2014-11-21 19:01:21részletek
377dietrend.huYes-Média Kft.2014-11-17 19:01:17részletek
378digital-mc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
379digitalis-emlekmentes.huVarga János2014-11-18 23:01:07részletek
380digitalis-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-19 19:01:02részletek
381digitalmc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
382digitalphoto.huDudásné Kovács Renáta EV2014-11-21 14:01:20részletek
383dignity.huEmberi Méltóság Központ2014-11-19 19:01:06részletek
384disz.huWebsupport s.r.o.2014-11-17 14:01:20részletek
385diszallatkutsera.huKutsera Balázs2014-11-20 19:01:01részletek
386diszkontcsempe.huHorváth András2014-11-19 19:01:17részletek
387dixdox.huDigital Packaging and Promotion Kft.2014-11-18 14:01:07részletek
388dizajnzokni.huHelyikupon KFt2014-11-21 14:01:27részletek
389djmakszim.huMakszim Botond 2014-11-21 19:01:02részletek
390djrici.huCivil-Network.hu Kft,2014-11-19 23:01:11részletek
391dkl-org.huDKL Műszaki Organizációs Kft.2014-11-17 19:01:04részletek
392dnscarbon.huVarga Dénes2014-11-18 14:01:12részletek
393do-re-mi.huMíves Kft.2014-11-17 19:01:05részletek
394dobosarnyekolastechnika.huDobos József ev.2014-11-18 23:01:10részletek
395dogfurniture.huVágner Adrienn2014-11-18 14:01:11részletek
396dohanyellato.huKovács Péter2014-11-15 14:01:03részletek
397dolgosmama.huKovácsné Fenyõ Erzsébet2014-11-19 23:01:04részletek
398domainaffiliate.huMonitor Média Kft.2014-11-20 14:01:07részletek
399domainajanlatok.huMonitor Média Kft.2014-11-20 14:01:06részletek
400domainstartup.huMonitor Média Kft.2014-11-20 14:01:11részletek
401domainstreet.huMonitor Média Kft.2014-11-20 14:01:06részletek
402domino51.huDominó 5/1 Kft2014-11-21 19:01:15részletek
403dominovendeghaz.huEuroDNS S.A.2014-11-17 14:01:17részletek
404doorandglass.huHorváth Gábor2014-11-17 14:01:11részletek
405doorandglassdesign.huHorváth Gábor 2014-11-17 14:01:13részletek
406dotindot.huFerenczi Gábor2014-11-17 19:01:02részletek
407dovre.huWebsupport s.r.o.2014-11-18 14:01:10részletek
408dpelectro.huVértesi Outlet Kft.2014-11-19 23:01:10részletek
409dragonage.huAngyal Levente2014-11-21 14:01:02részletek
410drdata.huVárkonyi Attila2014-11-17 19:01:22részletek
411dreamday.huKender Anita2014-11-17 19:01:08részletek
412dreamfotostudio.hudr Bereczky Orsolya2014-11-20 14:01:03részletek
413drharsanyi.hudr Harsányi Ádám Marcell2014-11-19 14:01:09részletek
414driveroftheyear.huLeasePlan Hungária Zrt.2014-11-21 19:01:03részletek
415drkissedit.huBánhalmi András2014-11-18 19:01:04részletek
416drkocsismaria.hudr. Kocsis Mária2014-11-21 19:01:05részletek
417droidsecurity.huFarkas István2014-11-20 14:01:06részletek
418dronewebshop.huBóna Dániel2014-11-18 14:01:01részletek
419dronkozpont.huFarkas István2014-11-20 14:01:13részletek
420drtouchscreen.huKrausz Tamás2014-11-17 14:01:08részletek
421drvacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:07részletek
422drvacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:19részletek
423ds-drive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
424dsdrive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
425dugás.huDiczkó Csaba2014-11-20 19:01:10részletek
426dugodijzona.huMedia Organisation Kft2014-11-19 23:01:12részletek
427dugulaselharitas.2000.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:12részletek
428dugulaselharitas.ingatlan.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
429dugulaselharitas.lakas.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
430dugulaselharitas.org.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
431dugulaselharitas.video.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
432duly.huEuromarknet Kft. (Registrar)2014-11-21 14:01:07részletek
433dunamentiborok.huWebsupport s.r.o.2014-11-19 19:01:23részletek
434duphalac.huAbbott Laboratories (Magyarország) Kft.2014-11-19 19:01:22részletek
435dvparking.huDV Info Informatikai Kft.2014-11-21 23:01:02részletek
436dxnganodermakave.huVécsei Renáta2014-11-21 14:01:19részletek
437dxnmegoldas.huCA Megoldás Kft.2014-11-18 23:01:08részletek
438dynamitebaits.huHalász László2014-11-17 19:01:16részletek
439e-dietetikus.huBallai Márta2014-11-18 14:01:30részletek
440e-inst.huHambuch Henrik2014-11-21 14:01:09részletek
441e-tablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:03részletek
442eaglesolutions.huMajoros Dóra2014-11-21 14:01:30részletek
443eatup.huKubicza Food & Drink Kft.2014-11-21 23:01:04részletek
444ebook-webshop.huWisol Kft.2014-11-21 19:01:14részletek
445eciconf-2012.huKrix Zoltán2014-11-19 19:01:14részletek
446ecoheat.huSzél Zoltán2014-11-17 19:01:14részletek
447ectv.huEuroCable Magyarorszag Kft.2014-11-21 19:01:21részletek
448ededesign.huPojtli Gábor E.V.2014-11-17 19:01:12részletek
449edesannacukraszdak.huDIAN CAFFE Kft.2014-11-18 14:01:28részletek
450edzoviki.huMolnár-Varhol Viktória2014-11-21 19:01:16részletek
451egain.huGarts hungary kft2014-11-21 19:01:01részletek
452egercity.huKrix Zoltán2014-11-19 19:01:09részletek
453egerhonlapkeszites.huBotos Regina2014-11-19 14:01:11részletek
454egeszsege.huUlicska Tamás2014-11-21 19:01:21részletek
455egeszseges-kulacs.huR&B Medilek spol. s r.o.2014-11-18 14:01:15részletek
456egeszsegestudomany.huEgészség és Tudomány Bt.2014-11-20 14:01:04részletek
457egvkft.huÉGV Kft.2014-11-20 19:01:04részletek
458egyetemipolo.huZoltán Balázs2014-11-21 14:01:30részletek
459egyetempolo.huZoltán Balázs2014-11-21 14:01:27részletek
460egzotikusutazasok.huForró Tamás Attila2014-11-18 19:01:06részletek
461ehko.huEhKo Sign Industries Kft.2014-11-19 14:01:20részletek
462eladominden.huKondász Róbert2014-11-21 14:01:06részletek
463electra-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:13részletek
464elektrovillbau.huEVB Építő Kft.2014-11-17 19:01:10részletek
465elelemetterem.huÉl-Elem Étterem Kft.2014-11-17 14:01:22részletek
466eletital.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
467eletpalyaori.huKiss Gergely E.V.2014-11-21 19:01:13részletek
468eletvezetesitanacsadas.huDr. Asztalos Attila2014-11-17 14:01:21részletek
469eletvezetesitanacsado.huDr. Asztalos Attila2014-11-17 14:01:21részletek
470elfogadoszeretet.huJ. KOVÁCS JUDIT2014-11-21 14:01:26részletek
471eliteitsys.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
472elitetetofedes.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
473elitshop.huOpen Solutions Kft. 2014-11-20 14:01:02részletek
474eljegyzesigyuruk.huVér József2014-11-17 14:01:12részletek
475elomult.huHortobágyi Ágoston2014-11-19 23:01:08részletek
476elsomagyarmegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
477elsomilliom.huPistyur Veronika2014-11-18 14:01:27részletek
478elvisz-busz.huK. és Z. Bt.2014-11-20 19:01:18részletek
479emmt.huWebenlét Kft.2014-11-20 14:01:05részletek
480englishteashop.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
481engyk.huNoname Domain Kft.2014-11-21 14:01:18részletek
482enterschool.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
483entersuli.huLauritzen Instore Kft.2014-11-21 14:01:04részletek
484entone.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
485epishop.huWildenert s.r.o.2014-11-19 19:01:04részletek
486epitesi-hibak.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
487epitesihibakfolyoirat.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
488epitesihibakmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
489epitesihibakszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
490epitesiminoseg.huBertoja-Berend András2014-11-20 19:01:15részletek
491epitesitabla.huWebenlét Kft.2014-11-16 19:01:04részletek
492epitoanyagportal.huKirály Zsolt2014-11-17 19:01:22részletek
493epitoaruhaz.huGerbner Dániel Ádám2014-11-20 14:01:09részletek
494epitobolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
495epitowebaruhaz.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
496epng.huIxor.hu Kft2014-11-21 23:01:04részletek
497epsystem.huÉP-SYSTEM XXI KFT.2014-11-21 14:01:20részletek
498erdelyimagyarokkozossege.huWebsupport s.r.o.2014-11-17 19:01:08részletek
499erdino.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
500erdinopont.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
501erdosdenes.huErdős Dénes2014-11-17 19:01:20részletek
502eriknewmanmusic.huExtrico Systems Hungary Zrt.2014-11-20 19:01:21részletek
503erintesfurdo.huKállai Éva Egyéni Vállalkozó2014-11-20 19:01:01részletek
504erstejotett.huWUNDERMAN Marketing Tanacsado Kft2014-11-21 14:01:24részletek
505ertekekhaza.huSzimbiózis a Harmonikus Együtt-létért Alapítvány2014-11-18 23:01:11részletek
506erzsebetovi.huEsztergomi Erzsébet Királyné Óvoda2014-11-22 23:01:01részletek
507esernyő-shop.huTóth Péter E.V.2014-11-20 14:01:04részletek
508esikon.huD 180 Kft.2014-11-20 14:01:04részletek
509eskuvo1x1.huÁrvai Tibor2014-11-21 19:01:07részletek
510eskuvotoszkana.huVarga-Kovács Tímea2014-11-21 14:01:28részletek
511espiro.huDevron-Impex Kft2014-11-19 14:01:18részletek
512etablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:05részletek
513etteremlatogato.huSzilléri Kft.2014-11-18 14:01:22részletek
514eumail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
515euphoriaorg.huTroll Gergő2014-11-20 14:01:08részletek
516euro.city.huKántor László2014-11-21 19:01:06részletek
517eurokartevoirtas.huDomoszlai Dávid2014-11-17 14:01:15részletek
518euronyelviskola.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:15részletek
519europacantat.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:10részletek
520europacantatpecs.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:09részletek
521europe-motion.huEurope Motion Kft.2014-11-18 23:01:09részletek
522europroperty.huUdut Attila2014-11-21 19:01:04részletek
523eva-blog.huBerecz Istvánné2014-11-18 23:01:23részletek
524evakonyvek.huSalyámosy Gáborné2014-11-15 14:01:03részletek
525evendi.hueVendi GmbH & Co. KG2014-11-20 14:01:01részletek
526everydaybudapest.huMudra László2014-11-17 14:01:15részletek
527evezzobudan.huGanz Villamossági Evezős Klub 2014-11-18 14:01:15részletek
528evilangel.huEuroDNS S.A.2014-11-20 14:01:11részletek
529ewordoc.huRoxboro Hungary Kft.2014-11-21 19:01:18részletek
530exertus.huExertus Trade Kft2014-11-20 19:01:08részletek
531ezsport.huSWA Szervíz Kft2014-11-17 19:01:01részletek
532ezteszed.huGórász Gréta2014-11-19 14:01:07részletek
533ezustpallos.huBodnár Balázs2014-11-18 23:01:17részletek
534építési-hibák.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
535építésihibák.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
536építésihibákfolyóirat.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
537építésihibákmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
538építésihibákszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
539f-h.huISD DUNAFERR Zrt.2014-11-17 19:01:17részletek
540f50divataru.huTóth Anita2014-11-18 23:01:20részletek
541fabutorpecs.huPernyéz Viktor2014-11-20 19:01:20részletek
542factory-outlet.huIT Remarketing Kft.2014-11-19 14:01:12részletek
543factoryoutlet.huIT Computer Trading Kft.2014-11-19 14:01:19részletek
544faeka.huHenkel Magyarország Kft2014-11-17 19:01:09részletek
545familiatermekek.huPick Szeged Zrt.2014-11-18 14:01:24részletek
546famousmusic.huNép Anita2014-11-21 23:01:04részletek
547fantasticstores.huSzombati Gergő László2014-11-21 14:01:16részletek
548fapadoshosting.huFarago Sandor2014-11-21 14:01:27részletek
549fapadoshoszting.huFarago Sandor2014-11-21 14:01:23részletek
550farkasfitness.huFarkas Gyula2014-11-20 14:01:14részletek
551farmrtk.huFöldmérési és Távérzékelési Intézet2014-11-18 14:01:05részletek
552fashionizer.huSCHWABEN CONSULTING Bt.2014-11-19 14:01:11részletek
553fatness2fitness.huSzűcs Eszter2014-11-21 23:01:03részletek
554fdmtrade.huFDM TRADE Kft.2014-11-17 14:01:13részletek
555fehervarparodontologus.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:11részletek
556fejlesztot-keresek.huMolnár István2014-11-19 23:01:07részletek
557feketehegyingatlan.huSzáler Gábor2014-11-17 14:01:14részletek
558feketepéntek.huZebrateam Kft2014-11-21 23:01:02részletek
559feketezzunk.huEgyütt az Iskoláért Alapítvány2014-11-18 23:01:21részletek
560felarak.huWebsupport s.r.o.2014-11-19 23:01:07részletek
561fellepo.huMihalik Béla Csaba2014-11-17 14:01:10részletek
562felnottbalett.huNagy-Hegyi Richárd2014-11-21 19:01:18részletek
563feloras.huCsontos István2014-11-19 14:01:22részletek
564femme.huSzmola Erika2014-11-19 14:01:16részletek
565festekwebbolt.huPoli-Farbe Kft.2014-11-17 19:01:18részletek
566feszek-ingatlan.huBooster Média Marketing Szolgáltató Kft.2014-11-20 14:01:04részletek
567fémdetektor.huDETECT MAX HUNGARY Kft.2014-11-17 19:01:02részletek
568fhtd.huFülep Dávid2014-11-21 19:01:16részletek
569fiataltehetsegekertalapitvany.huFiatal Tehetségekért Alapítvány2014-11-18 19:01:04részletek
570ficur.huFüzesséry Anikó2014-11-19 23:01:03részletek
571ficurapacban.huFüzesséry Anikó2014-11-19 23:01:03részletek
572filmbackground.huFilm Background Kft.2014-11-20 19:01:13részletek
573firststep-app.huDr. Tilinger Attila2014-11-21 14:01:25részletek
574fish-n-tech.co.huCsiba Gergely2014-11-19 14:01:02részletek
575fish-n-tech.huCsiba Gergely2014-11-19 14:01:03részletek
576fishntech.co.huCsiba Gergely2014-11-20 14:01:01részletek
577fishntech.huCsiba Gergely2014-11-19 14:01:20részletek
578fitmoka.huGolden Highway KFT2014-11-19 14:01:04részletek
579fitt-dancearena.huVidám Mária2014-11-21 19:01:16részletek
580fittmoka.huGolden Highway KFT2014-11-19 14:01:05részletek
581fizessokosan.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
582fler.huKrix Zoltán2014-11-19 19:01:16részletek
583flexfitness.huFarkas Gábor2014-11-21 19:01:04részletek
584florabalance.huGoodwill Pharma Orvos és Gyógyszertudományi Kereskedelmi és Szolgáltató Kft.2014-11-21 14:01:08részletek
585fodel.huHofer Sándor2014-11-19 14:01:08részletek
586fodraszpenztargepek.huNazza Software Kft.2014-11-17 19:01:13részletek
587fogadaspont.huKrix Zoltán2014-11-19 19:01:07részletek
588fogas.huKiss Péter2014-11-10 14:01:12részletek
589fogcomputing.huFaragó Róbert2014-11-18 23:01:17részletek
590fogszabalyozas-otthon.huArany Generáció Kft.2014-11-20 19:01:12részletek
591fogszabalyozasszekesfehervaron.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:03részletek
592fogyizo.huTerra Herba Kft.2014-11-19 14:01:21részletek
593folyamituzoltosag.huZotmund Pál2014-11-17 14:01:06részletek
594foniciachange.huFőnicia Cash Change Kft2014-11-20 19:01:13részletek
595fontanetmedia.huVajk László2014-11-21 19:01:11részletek
596foodintertrade.huFood Intertrade Kft.2014-11-20 19:01:16részletek
597forcenix.huForcenix Solutions Kft2014-11-21 14:01:08részletek
598foresightsports.huNoramtech Bt.2014-11-18 23:01:05részletek
599forintfitnesz.huHuszthy Gergely Balázs2014-11-18 14:01:03részletek
600formiko.huFormiko Kft2014-11-19 23:01:03részletek
601forside.huDuna House Franchise Kft.2014-11-21 14:01:13részletek
602fortepiano.huBalogh Csaba2014-11-20 14:01:02részletek
603forthekids.huDenke Dániel2014-11-19 14:01:19részletek
604fortuna-ingatlan.huFortuna Ingatlan és Hiteliroda2014-11-19 19:01:20részletek
605foto64.huBarna Buxbaum2014-11-19 19:01:13részletek
606fotoslany.huMegoldás Webügynökség Kft.2014-11-20 14:01:04részletek
607fotosvagyok.huRozsnyai Zsolt2014-11-18 14:01:08részletek
608fozo-ust.huIstella Tamás2014-11-18 14:01:25részletek
609fozomania.huVereb Adrienn2014-11-20 19:01:03részletek
610franciae-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
611franciaforditas.huKiss-Boros Beatrix2014-11-19 14:01:18részletek
612frenchbulldogs.huFlashdigital Bt.2014-11-19 23:01:08részletek
613frendy.huGebi Hungary Kft2014-11-19 14:01:02részletek
614frendywendy.huGebi Hungary Kft2014-11-19 14:01:13részletek
615freshmood-design.huCsapó Zsuzsanna2014-11-18 23:01:24részletek
616frima.huKombi Plusz Kft2014-11-17 14:01:04részletek
617fritzland.huHorváth-Hegyi Dénes2014-11-19 19:01:21részletek
618fuggonyfal.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
619fuggonyfalak.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
620fuggonyfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
621fuggonyfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:14részletek
622fullarts.huKrix Zoltán2014-11-19 19:01:07részletek
623fundance.huMelkvi Zsuzsa2014-11-21 14:01:02részletek
624funds4i.huVicze Gabor2014-11-18 14:01:16részletek
625funkymonkeymedia.huRusznak Laszlo2014-11-21 14:01:06részletek
626furgonbolt.huBelus Zsolt2014-11-21 23:01:02részletek
627futesalkatresz.huTHERMO-SZERVIZ Kft.2014-11-21 19:01:16részletek
628futopanelaruhaz.huPelle és Pelle Kft.2014-11-18 23:01:10részletek
629futopaneluzlet.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
630futopolok.huIguana Computers Bt.2014-11-21 14:01:22részletek
631fx21.huRozgonyi György2014-11-20 19:01:08részletek
632g-styleforyou.huMuhi Gabriella2014-11-19 19:01:12részletek
633gabormiklos.huGábor Katalin2014-11-18 14:01:24részletek
634gabrieltemetkezes.huBrill Life Média Kft.2014-11-21 19:01:08részletek
635gadgetminutes.huUram János2014-11-21 14:01:21részletek
636galbalazs.huGál Balázs2014-11-20 14:01:04részletek
637galga-zagyva.huLantos Éva2014-11-19 23:01:05részletek
638gamberhosting.huKrix Zoltán2014-11-19 19:01:21részletek
639gammaplus.huOstrogonac József2014-11-20 19:01:01részletek
640gardrob.huKiberNet Kft.2014-11-18 19:01:02részletek
641gas-go.huGas-Go Magyarország Kft.2014-11-20 19:01:04részletek
642gastromuhely.huMohácsi Gábor2014-11-21 14:01:22részletek
643gastropapa.huWinkler László2014-11-21 14:01:29részletek
644gasztroda.huSzőke Mihály István2014-11-20 19:01:13részletek
645gasztromuhely.huMohácsi Gábor2014-11-21 14:01:01részletek
646gather.huEcsedi Ádám2014-11-17 19:01:19részletek
647gazhalozatszerelo.huFarkas Zsolt2014-11-19 19:01:19részletek
648gazkeszulekbudapest.huIzsold János2014-11-20 14:01:10részletek
649gdse.huLukács Gábor2014-11-17 14:01:24részletek
650gebi.huGebi Hungary Kft2014-11-19 14:01:07részletek
651geodrone.huGeomentor Kft2014-11-18 14:01:15részletek
652geopolitics.huWiking Számítástechnika Kft2014-11-18 23:01:13részletek
653gergelysanyi.huGergely Sándor2014-11-20 19:01:21részletek
654geszlerkft.huGeszler Kft.2014-11-18 14:01:14részletek
655getsportjob.huWebsupport s.r.o.2014-11-20 19:01:04részletek
656giftshopping.huWebsupport s.r.o.2014-11-17 19:01:05részletek
657glimark.huKovács Imre2014-11-18 23:01:06részletek
658glitter.huPekárovics Gábor2014-11-19 14:01:06részletek
659globalsummit.huBalogh Sándor2014-11-17 14:01:20részletek
660glosbe.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
661gmtscomm.huGMTS COMM Kft2014-11-19 14:01:13részletek
662goazis.huVajda Péter2014-11-17 19:01:11részletek
663gobliners.huCsanádi Viktor2014-11-20 19:01:13részletek
664goldenstar.huPápai Petra2014-11-20 14:01:15részletek
665goldicon.huOroszi Károly2014-11-18 14:01:29részletek
666gomarketmail.huWebmédia Market Kft.2014-11-19 14:01:10részletek
667gombnyomasra.huKaraba György2014-11-20 14:01:07részletek
668gombsulyzo.huIllés László2014-11-19 14:01:22részletek
669goncbolha.huPC-Fenomén Kft.2014-11-17 19:01:12részletek
670gondolkodjunkegyutt.huKrix Zoltán2014-11-19 19:01:10részletek
671gondozohaz.huUnidomain Kft.2014-11-17 14:01:06részletek
672goodmorningbudapest.huKrix Zoltán2014-11-19 19:01:04részletek
673googlebolt.huMegaline Stúdió Kft.2014-11-19 19:01:04részletek
674goulashchef.huAgrocorp Consulting Kft2014-11-21 14:01:30részletek
675goulashinstitute.huAgrocorp Consulting Kft2014-11-21 14:01:26részletek
676gourmetboutique.huGRAPIXX HOSTING KFT.2014-11-17 19:01:12részletek
677grafikaszak.huHurton Tamás2014-11-18 23:01:20részletek
678grandechico.hu Berger Gasztro Kft.2014-11-17 14:01:10részletek
679gravirfalva.huKovács Szabolcs2014-11-19 14:01:19részletek
680greenlandarea.huKovács Csaba2014-11-20 14:01:07részletek
681greenvulcano.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
682grill-sziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:10részletek
683grillsziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:09részletek
684gromatea.huGrófi Major Kft.2014-11-19 14:01:05részletek
685grundigshop.huBreyer Balázs2014-11-11 19:01:12részletek
686gtconsulting.huGergály Tamás2014-11-16 19:01:05részletek
687gyemanthomoki.huKrix Zoltán2014-11-19 19:01:09részletek
688gyemantmezo.huNetworking Kelet-Magyarország Kft.2014-11-17 19:01:16részletek
689gyerekagybolt.huNapjaink Kft.2014-11-18 23:01:19részletek
690gyerekágybolt.huNapjaink Kft.2014-11-18 23:01:20részletek
691gyerekjátékshop.huHajnal Zsombor EV2014-11-17 19:01:19részletek
692gyerekzokini.huÖko-PC Kft.2014-11-21 19:01:15részletek
693gyermekfantazia.huAntal Ferencné2014-11-21 14:01:10részletek
694gyermekfogaszatszekesfehervar.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:09részletek
695gyermekmegtakaritas.huMesszi-Szabó Gábor2014-11-19 19:01:05részletek
696gyiq.huŐcsi Balázs E.V.2014-11-21 14:01:28részletek
697gymready.huKatschthaler Gabriella2014-11-19 14:01:17részletek
698gyogylaser.huBálint Imre2014-11-17 19:01:06részletek
699gyogynoveny.info.huGomoa Trade Kft2014-11-19 14:01:22részletek
700gyogyul.huUlicska Tamás2014-11-21 19:01:21részletek
701gyogyulni.huUlicska Tamás2014-11-21 19:01:21részletek
702gyongyszemmoletti.huBenda János Róbert2014-11-21 14:01:02részletek
703gyonimajor.huZlinszky Ferenc2014-11-16 19:01:02részletek
704gyoparos-terapia.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
705gyukadental.huGyuka-Dental Kft.2014-11-19 14:01:11részletek
706habi-epker.huHabi-Épker Kft.2014-11-18 23:01:06részletek
707hair4u.huHD Group Kommunikacios Ugynokseg Kft.2014-11-17 14:01:12részletek
708hajdusagisorstarsak.huHajdúsági Sorstársak Együtt Egymásért Egyesülete2014-11-17 14:01:07részletek
709hajszalhijjan-jog.huAnonymouse Domains s.r.o.2014-11-20 19:01:09részletek
710halkalauz.huJónap Richárd2014-11-17 19:01:04részletek
711hamleys.co.huHamleys of London Ltd.2014-11-19 23:01:05részletek
712hangulatvarazs.huPilling Tünde2014-11-19 14:01:07részletek
713hannapalinka.huÁsványi Anikó2014-11-21 14:01:05részletek
714hantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:14részletek
715happyfoodcoffee.huHappy Food & Coffee Kft2014-11-19 19:01:18részletek
716hardwareonline.huKrix Zoltán2014-11-19 19:01:11részletek
717harkany.hotel.huPaqart design Kft.2014-11-17 14:01:07részletek
718harsanyiistvandij.huManager Képzés Alapítvány2014-11-20 14:01:03részletek
719hasznalt-fenymasolok.huProfil-Copy 2002 Kft.2014-11-17 14:01:02részletek
720hazbolt.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
721házipornó.huDiczkó Csaba2014-11-21 14:01:15részletek
722heilung.huUlicska Tamás2014-11-21 19:01:11részletek
723helenaszappan.huBlind Bt. 2014-11-21 14:01:13részletek
724helibudapest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
725helipest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
726hellotelo.huHellotelo Telekommunikációs Kft.2014-11-22 23:01:02részletek
727helperek.huDr. Szeles Géza EV2014-11-21 14:01:17részletek
728helpme.huNetworKing Informatika Kft.2014-11-17 19:01:09részletek
729herbariabalance.huChrien Károly2014-11-19 14:01:04részletek
730herbatunder.huTelekom-Line Kft.2014-11-20 19:01:12részletek
731heshunfa.huHeshunfa Kft.2014-11-21 14:01:17részletek
732hetimenu.huSimó István2014-11-21 14:01:23részletek
733hetret.huKrix Zoltán2014-11-19 19:01:08részletek
734hetta.huHepp Brigitta2014-11-18 14:01:24részletek
735hidraulikajaszbereny.huSzele-Főnix Kft.2014-11-18 14:01:18részletek
736hifanovenyvedoszerkereskedelem.huZEMPLÉN-MAG Kft.2014-11-19 19:01:04részletek
737highfashion.huEuroDNS S.A.2014-11-17 14:01:23részletek
738hintaló.huFehér Zsolt2014-11-20 14:01:03részletek
739hiperdonkey.huWebsupport s.r.o.2014-11-22 23:01:01részletek
740hiperhaver.huHiper-Aktív Family Kft2014-11-20 14:01:02részletek
741hirekazorszagbol.huSWA Szervíz Kft2014-11-17 19:01:14részletek
742hirekelsokezbol.huSWA Szervíz Kft2014-11-17 19:01:15részletek
743hirlevel-kikuldes.huBoardland.hu Kft. 2014-11-20 19:01:22részletek
744hitelmonitor.huRácz Attila2014-11-21 19:01:12részletek
745hivatalosforras.huMárton Géza2014-11-21 14:01:11részletek
746hnkozetkeztetes.huTóth Imre2014-11-19 19:01:11részletek
747ho-ho.huNagyné Herczeg Eszter2014-11-19 14:01:15részletek
748hobbikezilabda.huSWA Szervíz Kft2014-11-17 19:01:14részletek
749homebeer.huRácz Dávid2014-11-21 14:01:20részletek
750homepilates.huKocsis Katalin2014-11-20 19:01:19részletek
751hondakalogep.huKaló István2014-11-18 23:01:09részletek
752honlapszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
753honlaptervezok.huD-Com Group Kft2014-11-17 19:01:16részletek
754hontvari.huKovácsné Hontvári Krisztina2014-11-19 14:01:07részletek
755honvedelemertklub.huMihályi Produkció KFT.2014-11-21 14:01:01részletek
756hooh.huMayer Norbert2014-11-18 23:01:04részletek
757hopika.huIllyés Dezsõ2014-11-19 19:01:03részletek
758horfa.huHorváth György2014-11-18 14:01:16részletek
759horgasztaborok.huGeicz-Molnár Szilvia2014-11-18 23:01:09részletek
760horgolt.huCogitate Games Kft.2014-11-19 19:01:18részletek
761horvateskuvo.huSzabó László2014-11-18 14:01:07részletek
762horvathszervizmihalyi.huBedi Ervin E.V.2014-11-20 14:01:07részletek
763hpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
764hpica.huEcologinform Kft.2014-11-15 14:01:03részletek
765hpu.huUnidomain Kft.2014-11-19 19:01:15részletek
766hualan.huHualan Kft.2014-11-21 14:01:04részletek
767hugs.huLenka Baldrianova2014-11-18 14:01:27részletek
768humydry.huEuroDNS S.A.2014-11-18 23:01:12részletek
769hungarizalj.huSzabó Balázs Ev.2014-11-18 23:01:16részletek
770hungarymail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
771hungarytrip.huBenedek Csilla2014-11-20 14:01:07részletek
772hunpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
773hunyadygabor.huConsult Unio Kft2014-11-18 14:01:21részletek
774hunyatefu.huKrix Zoltán2014-11-19 19:01:09részletek
775hurrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
776hürrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
777i-partner.huPelican System Kft.2014-11-20 19:01:10részletek
778iberianfoods.huEuroDNS S.A.2014-11-17 14:01:02részletek
779icamamahusboltja.huBia-Dia Faloda Kft2014-11-18 14:01:19részletek
780icomplete.huWhite Fluffy Cloud Limited2014-11-17 14:01:10részletek
781icrypt.huINTEGRITY Kft.2014-11-20 19:01:22részletek
782ideveled.huKhaut Zsolt2014-11-21 14:01:18részletek
783idezetbolt.huFeki Webstudio Kft.2014-11-19 19:01:07részletek
784idezetportal.huFeki Webstudio Kft.2014-11-19 19:01:06részletek
785idezetshop.huFeki Webstudio Kft.2014-11-19 19:01:18részletek
786idezettar.huFeki Webstudio Kft.2014-11-19 19:01:17részletek
787idojaras-sopron.huHelyes Gábor2014-11-20 19:01:06részletek
788idromatic.huNatur Wash Kft.2014-11-19 14:01:10részletek
789ieskft.huIpari Elektronikai Szervíz Kft.2014-11-18 14:01:18részletek
790iexpress.huRocskar Tibor2014-11-17 14:01:23részletek
791igazmese.huKiss Erzsébet2014-11-19 14:01:15részletek
792imatic.huSólyomi Gábor2014-11-21 14:01:26részletek
793imcsi.huKöő Imre2014-11-18 23:01:22részletek
794imperialairsoft.huVárkonyi Zsolt Attila2014-11-21 14:01:09részletek
795impulsefitclub.huKisdaróczy Gábor2014-11-19 23:01:08részletek
796incipio.co.huEuromarknet Kft. (Registrar)2014-11-15 14:01:02részletek
797independencekey.huKocsis Tamás2014-11-17 19:01:17részletek
798industrial-property.co.huIndustrial-Property Kft2014-11-21 14:01:18részletek
799info-központ.huMéta Kereskedelmi Kft.2014-11-19 14:01:16részletek
800infoksport.huSWA Szervíz Kft2014-11-17 19:01:14részletek
801infoter.huCetinje s.r.o.2014-11-22 23:01:01részletek
802ingatlan-balaton.huKovács Attila2014-11-18 14:01:09részletek
803ingatlan-guru.huPethő Eszer2014-11-20 14:01:08részletek
804ingatlan-ker.huGigaweb Kft2014-11-18 14:01:24részletek
805ingatlanconsulting.huNRG-TECH GLOBAL Kft.2014-11-17 19:01:01részletek
806ingatlanmobil.huDr Várhegyi Ügyvédi Iroda2014-11-17 14:01:09részletek
807ingyenporno.co.huBuzsik Róbert2014-11-21 19:01:15részletek
808injex.huDr. Antolik Marianna2014-11-21 19:01:07részletek
809innobyte.huInnobyte Informatikai Korlátolt Felelősségű Társaság2014-11-21 19:01:04részletek
810innoco.huDr. Fekete Róbert Tamás2014-11-21 14:01:05részletek
811integralmedia.huInvestment Marketplace Zrt.2014-11-21 14:01:11részletek
812intellegoextra.huCzellár István Zénó2014-11-21 19:01:13részletek
813intellicon.huOrosz Péter2014-11-17 19:01:07részletek
814intermail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
815interplex.co.huInterplex Hungary, Kft.2014-11-18 14:01:24részletek
816intertrade.huVeres Tamás2014-11-21 14:01:29részletek
817intimajandek.huIllés Krisztina2014-11-21 14:01:05részletek
818intimtorna-budapest.huIlok-Székely Zsanett2014-11-18 19:01:05részletek
819investola.huSteier Márton2014-11-18 19:01:07részletek
820iparifutesek.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
821ipole.huUdvardy Sára2014-11-17 19:01:13részletek
822iq-szerviz.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:16részletek
823iqszervizkft.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:18részletek
824irenkesegit.huMárkus Ágnes2014-11-20 14:01:08részletek
825iroda-guru.huPethő Eszer2014-11-20 14:01:08részletek
826irodakraktarak.huHarkácsi István2014-11-20 19:01:09részletek
827ispot.huNagy-Barta József2014-11-21 19:01:20részletek
828istvankalmar.huKalmár István2014-11-18 23:01:24részletek
829it-happens.huIT-HAPPENS Kft.2014-11-19 23:01:08részletek
830itacademy.huKrix Zoltán2014-11-19 19:01:09részletek
831itart.huSzták András2014-11-20 14:01:12részletek
832itcegek.huwebformance Kft.2014-11-20 19:01:08részletek
833ityuk.huWebsupport s.r.o.2014-11-17 14:01:19részletek
834iyassu.huBerenyi Rita2014-11-20 19:01:20részletek
835janafoto.huVarga-Kovács Janka 2014-11-19 23:01:07részletek
836jannus.huCsillag Kiadó Kft.2014-11-18 14:01:04részletek
837jarmuvetel.huA111 Autó Kft.2014-11-18 23:01:15részletek
838javaszoftverfejlesztes.huSinkovits Balázs2014-11-20 19:01:16részletek
839jazminpakoca.huRemetei Tamás2014-11-19 19:01:19részletek
840jazzlexikon.huFenyős Zoltán2014-11-21 14:01:04részletek
841jbdesign.huMihalics Bernadett2014-11-19 19:01:22részletek
842jeebalaton.huKrix Zoltán2014-11-19 19:01:09részletek
843jobtogo.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
844jogalap.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:16részletek
845jogaswing.huZYD-Szer Kft.2014-11-18 14:01:06részletek
846jogkozpont.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:17részletek
847jogporta.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:28részletek
848jogszinter.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:01részletek
849jogterulet.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:16részletek
850jogweb.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:17részletek
851johirnevklub.huTóth Zoltán2014-11-18 23:01:02részletek
852johnnybudapest.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
853josef.huUnidomain Kft.2014-11-19 19:01:03részletek
854jovofutese.huPelle és Pelle Kft.2014-11-18 23:01:08részletek
855jucuskonyhája.huFleischmann Pál2014-11-17 14:01:20részletek
856jujitsunyh.huBélteczki Csaba2014-11-20 19:01:18részletek
857jumbomedia.huSzabó Tamás2014-11-19 14:01:22részletek
858jumbó.huSzabó Tamás2014-11-19 14:01:08részletek
859jumbómédia.huSzabó Tamás2014-11-19 14:01:08részletek
860justnatural.huNagyné Csorba Zsuzsanna2014-11-18 14:01:16részletek
861kacagokacat.huEncziné Varga Andrea2014-11-17 19:01:21részletek
862kacsalla.huHATALA ZSOLT2014-11-18 19:01:03részletek
863kajdicomputer.huKajdi Roland2014-11-20 14:01:03részletek
864kalamarbeata.huKalamár Beáta ev.2014-11-19 23:01:10részletek
865kalapozz.huMészáros Gábor2014-11-19 14:01:17részletek
866kalauzhal.huJónap Richárd2014-11-20 19:01:15részletek
867kamion-alkatresz.huVér József2014-11-19 19:01:14részletek
868kamionreklam.huWalking Image Kft.2014-11-20 19:01:03részletek
869kampanykezeles.huMagyari Annamária2014-11-21 19:01:15részletek
870kaposvariprogramok.huFenyő Zsuzsanna2014-11-21 14:01:12részletek
871kapszegyfulest.huTV2 Média Csoport Kft.2014-11-21 14:01:02részletek
872karacsony2014.huMészáros Gábor2014-11-19 14:01:21részletek
873karaszutca.huDr. Módra Szilvia2014-11-21 19:01:09részletek
874karcagi-peter.huCogitate Games Kft.2014-11-18 14:01:29részletek
875karmablog.huTarnai Akos2014-11-18 14:01:03részletek
876karmakeramia.huYellow Consulting Kft.2014-11-19 14:01:12részletek
877kaszanyidora.huKaszanyi Dóra2014-11-17 14:01:16részletek
878katkawebdesign.huNagy Katalin2014-11-19 19:01:06részletek
879kekeper.huKovács Zoltán EV2014-11-19 14:01:13részletek
880keklagunahaz.huBest-Impex Kft2014-11-20 19:01:20részletek
881kekmadarovi.huPiroch Ágnes2014-11-15 14:01:02részletek
882kekpiramis.huTechcentral Kft.2014-11-17 23:01:02részletek
883keleterintese.huSzőke Attila2014-11-17 19:01:16részletek
884keleticsucsok.huBusiness Innovant Kft.2014-11-18 14:01:18részletek
885keleticsücsök.huBusiness Innovant Kft.2014-11-18 14:01:06részletek
886kelloggsvantage.huKellogg Europe Trading Limited2014-11-19 19:01:16részletek
887kendereskert.huTóth Imre2014-11-15 14:01:02részletek
888kepfelho.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
889keramixlighting.huKeramix Hungary Kft.2014-11-20 19:01:13részletek
890keretklub.huFinalArt Studio Kft.2014-11-19 14:01:21részletek
891kertalkotok.huMándoky Petra Dorottya 2014-11-17 23:01:02részletek
892kettlebellakademia.huIllés László2014-11-18 23:01:02részletek
893ketuszkapuvar.huMedSol Expert Kft.2014-11-21 19:01:11részletek
894kezsuvedelem.huKencse Zsuzsanna2014-11-21 14:01:04részletek
895képestok.huEz GSM Phone Kft.2014-11-19 23:01:03részletek
896kgstpiac.huKaczur Tibor2014-11-17 14:01:18részletek
897kilincsdesign.huB&M Mechanika Kft.2014-11-17 19:01:22részletek
898killercv.huSzulyovszky Lilla2014-11-21 19:01:10részletek
899kinesiology-tape.huM and M Interconsulting Bt.2014-11-18 23:01:09részletek
900kineziologiai-tapasz.huM and M Interconsulting Bt.2014-11-18 23:01:07részletek
901kinxstudio.huMounier Stephane Jean Pierre2014-11-21 14:01:18részletek
902kisit.huKis Norbert2014-11-20 14:01:04részletek
903kiskom.huKis Norbert2014-11-17 19:01:16részletek
904kislan.huKis Norbert2014-11-17 19:01:15részletek
905kisnemes.huNemes Attila2014-11-21 23:01:01részletek
906kispince.huKis Csaba2014-11-17 14:01:14részletek
907kisugarzas.huKardos Levente2014-11-18 19:01:06részletek
908kisvállalatirendszergazda.huSURIEL Informatikai Kft.2014-11-21 14:01:27részletek
909kitsimono.huTirpák Bálint Gábor2014-11-18 23:01:14részletek
910kiwisuncosmetics.huHI-RE Kft2014-11-17 23:01:01részletek
911klacix.huKatona László2014-11-15 14:01:03részletek
912klinkercentrum.huTetőcentrum Magyarország Kft.2014-11-20 14:01:15részletek
913koborgo.huKiss Imre E.V.2014-11-19 14:01:20részletek
914kockasfuzet.huKarpf Sándor2014-11-21 23:01:01részletek
915kockatomb.huNagy Tibor2014-11-17 14:01:13részletek
916kockerd.huSzilágyi Antal2014-11-19 14:01:09részletek
917koltsegcsokkento.huUnidomain Kft.2014-11-19 19:01:13részletek
918kommunalistechnika.huOpal Média és Kommunikáció Bt.2014-11-21 19:01:20részletek
919kompetenspedagogus.huArató Ferenc2014-11-20 19:01:09részletek
920kondiguru.huKELET-TANÉRT Kft.2014-11-21 14:01:14részletek
921kondorosikk.huKondorosi Kézilabda Klub2014-11-21 19:01:03részletek
922kondorosikonyvtar.huDérczy Ferenc Könyvtár és Közművelődési Intézmény2014-11-21 14:01:16részletek
923konnyentanulas.huKrix Zoltán2014-11-19 19:01:14részletek
924kontinum.huKONTINUM Kft.2014-11-18 23:01:21részletek
925konyveloszentendren.huDominó 5/1 Kft2014-11-21 19:01:14részletek
926konyvetjoaron.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:25részletek
927konyvkoto.huBártfai Balázs2014-11-18 14:01:16részletek
928konyvtenger.huTimár Mátyás2014-11-19 14:01:05részletek
929korall-szepsegszalon.huVarga- Kovács Nikolett2014-11-17 14:01:23részletek
930korall-zazo.huZAZO Innovációs Holding Kft2014-11-17 19:01:07részletek
931korgforum.huDetvai Gyula2014-11-20 19:01:02részletek
932kornyezettudatos.huKump Edina2014-11-17 19:01:23részletek
933korosietterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:21részletek
934korruptkormany.huLeft-Wing Network Ltd2014-11-17 14:01:08részletek
935korsal.huSütő-Nagy Borbála2014-11-17 14:01:13részletek
936kosem.huTrivium Kiadó Kft.2014-11-17 14:01:21részletek
937koserpita.huSemes B'H Kft2014-11-21 14:01:26részletek
938kotai.huUnidomain Kft.2014-11-17 19:01:14részletek
939kották.huCsipai Roland2014-11-19 19:01:15részletek
940kozelhozzank.huGorea Loreta2014-11-21 19:01:20részletek
941kozmetikuspenztargepek.huNazza Software Kft.2014-11-17 19:01:17részletek
942kozosenmagyarorszagert.huKirály Béla2014-11-19 14:01:21részletek
943kölyökatlétika.huScheidler Géza2014-11-21 14:01:08részletek
944könyvetjóáron.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:11részletek
945körsál.huSütő-Nagy Borbála2014-11-18 23:01:20részletek
946kösem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
947kreateve.huRöhricht Szabolcs2014-11-16 19:01:06részletek
948kredencjava.huBusiness Innovant Kft.2014-11-18 14:01:15részletek
949krisztidesign.huSzelényi Krisztina2014-11-19 19:01:10részletek
950kriszwebdesign.huErdélyi Krisztián2014-11-19 19:01:22részletek
951kronikakonyvesbolt.huIntec Online Kft. (Registrar)2014-11-18 19:01:05részletek
952kronikasa.huCsordás Zoltán2014-11-18 14:01:25részletek
953kross-kerekpar.huBartusné Petkó Marietta2014-11-19 14:01:07részletek
954ktva.huKözép-Tiszai Vidékfejlesztő Alapítvány2014-11-19 19:01:02részletek
955kuldetesunk.huTóth Balázs2014-11-21 14:01:13részletek
956kuponajandeka.huKrix Zoltán2014-11-19 19:01:09részletek
957kuponozon.huNV SPEED KFT.2014-11-21 14:01:24részletek
958kutklima.huKeresztes László2014-11-19 14:01:02részletek
959kutyanevek-nevnapok.huNagy Gábor2014-11-19 19:01:14részletek
960kutyaneveknevnapok.huNagy Gábor2014-11-19 19:01:15részletek
961kzsdesign.huKozák Zsanett2014-11-19 19:01:05részletek
962lagunahome.huP.R. Fürdőszoba Kft.2014-11-17 19:01:12részletek
963lakas-guru.huPethő Eszer2014-11-21 14:01:08részletek
964lakashitelmonitor.huRácz Attila2014-11-21 19:01:11részletek
965lakashotel.huKovács Szabolcs Pál2014-11-19 23:01:04részletek
966lakashotelek.huKovács Szabolcs Pál2014-11-19 23:01:05részletek
967lakolap.huGerbner Dániel Ádám2014-11-19 23:01:03részletek
968laptopsuli.huLauritzen Instore Kft.2014-11-21 14:01:29részletek
969laptopszervizszolnok.huADACSA Kft.2014-11-18 14:01:27részletek
970lashandnail.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:18részletek
971lashvolution.huJPT Investment Partners Limited2014-11-21 19:01:02részletek
972lat6lak.huDoka Norbert2014-11-21 14:01:13részletek
973learmorszakszervezet.huDanka Attila2014-11-18 14:01:28részletek
974leboltgo.huX-Software Kft.2014-11-21 14:01:12részletek
975ledekboltja.huGreen Plan Energy Kft 2014-11-19 23:01:09részletek
976ledtvszerviz.huKomlós Zsolt2014-11-20 19:01:06részletek
977leglibirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:18részletek
978leglibor.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:21részletek
979legliotto.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:20részletek
980legliszolobirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:19részletek
981lego-webshop.huWebMeszler Kft.2014-11-10 14:01:59részletek
982legszebbnapra.huMacsek Istvánné E.V.2014-11-21 14:01:24részletek
983legterillatositas.huEmpresa Szolgáltató Bt2014-11-18 14:01:28részletek
984legvar60.huBertók Máté2014-11-19 19:01:03részletek
985legyelbator.huErdős Nóra2014-11-17 14:01:18részletek
986legyelboldog.huErdős Nóra2014-11-17 14:01:03részletek
987legyelegeszseges.huKrizsán Tamás2014-11-17 19:01:21részletek
988lehneruveg.huLéhner Szilveszter2014-11-20 19:01:19részletek
989lekocsma.huMuzslay Tamás2014-11-17 19:01:21részletek
990lelekiranytu.huKovács Zsolt2014-11-20 14:01:14részletek
991lelekvarazslat.huPilling Tünde2014-11-19 14:01:09részletek
992lem2-gyor.huInfoartnet Kft.2014-11-18 23:01:03részletek
993lenartgrafika.huLénárt Viktor2014-11-19 19:01:21részletek
994lepkeovigyor.huTárogató Óvoda Lepke Tagóvodája 2014-11-18 14:01:23részletek
995lifemaster.huMravik Zsolt2014-11-17 19:01:08részletek
996liftkamerak.huBolemányi Tibor E.V2014-11-19 19:01:18részletek
997lightandnature.huKrix Zoltán2014-11-19 19:01:13részletek
998likebaby.huDevron-Impex Kft2014-11-19 14:01:18részletek
999likeface.huKrix Zoltán2014-11-19 19:01:09részletek
1000limoforum.huKovács Imre2014-11-21 14:01:04részletek
1001lindt-shop.huDomain Robot Limited2014-11-16 19:01:02részletek
1002lindtshop.huDomain Robot Limited2014-11-16 19:01:03részletek
1003liquidsafe.huiHelpTrading Kft.2014-11-18 23:01:20részletek
1004lkwstore.huZsámbok János2014-11-20 19:01:18részletek
1005loginschool.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
1006loginsuli.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
1007londonetterem.huTóth Attila2014-11-17 19:01:16részletek
1008londoniszallas.huSilicium Network Kft. (Registrar)2014-11-17 14:01:03részletek
1009loom-band.huVil-For Kft. 2014-11-21 19:01:17részletek
1010loom-bands.huVil-For Kft. 2014-11-21 19:01:20részletek
1011louisxivenergy.huMucsi Gergely2014-11-18 23:01:21részletek
1012lstm.huLSTM ipari, kereskedelmi és szolgáltató Kft.2014-11-21 14:01:19részletek
1013lukacsipapir.huLukácsi Mercédesz2014-11-20 14:01:08részletek
1014luxus-szonyeg.huVarga Gergő2014-11-20 19:01:15részletek
1015luxusszonyeg.huVarga Gergő2014-11-20 19:01:11részletek
1016lxy.huDömötör Tímea Zsuzsanna2014-11-18 14:01:02részletek
1017lyngsat.huEuroCable Magyarorszag Kft.2014-11-10 14:02:10részletek
1018m15residence.huM15 Villa Rezidencia Kft.2014-11-18 23:01:03részletek
1019m35.huUndefasa Kft. 2014-11-19 19:01:04részletek
1020maasdamer.huFoodnet Kft.2014-11-21 19:01:18részletek
1021maasdami.huFoodnet Kft.2014-11-21 19:01:18részletek
1022madohome.huDagdelen Emrah2014-11-18 19:01:03részletek
1023mafoakademia.huMagyarországi Foglalkoztatási és Oktatási Kft.2014-11-21 14:01:25részletek
1024mafoakadémia.huMagyarországi Foglalkoztatási és Oktatási Kft.2014-11-20 19:01:17részletek
1025mag250.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1026maganerdesz.huHorváth Gábor2014-11-19 14:01:13részletek
1027maganraktar.huBlinszki László2014-11-17 19:01:02részletek
1028magastatra.huPrime Media s.r.o.2014-11-22 23:01:02részletek
1029magmametal.huSzádvári Gábor 2014-11-20 19:01:09részletek
1030magnoliaekszer.huAbonyi-Szabó Emese2014-11-21 14:01:11részletek
1031magyarfotokabin.huVarga Toth Maria2014-11-17 14:01:01részletek
1032magyarrss.huKrix Zoltán2014-11-19 19:01:07részletek
1033mah-pyrogas-kazan.huMészáros Attila2014-11-20 14:01:06részletek
1034mailworx.hueworx Network & Internet GmbH2014-11-18 14:01:27részletek
1035majomlampa.huAu Cash Kft.2014-11-21 19:01:05részletek
1036majorfoldmunkak.huMajor Földmunkák Kft. 2014-11-21 14:01:28részletek
1037malimo.huRobonet BT2014-11-20 14:01:09részletek
1038mammutneckermannsport.huPartner Kft.2014-11-19 14:01:15részletek
1039mandateka.huMagyar Nemzeti Digitális Archívum és Filmintézet2014-11-21 19:01:03részletek
1040mango-masszazs.huBusiné Szilágyi Szilvia E.V.2014-11-21 19:01:13részletek
1041marcalihollandbutor.huBogár Richárd2014-11-21 19:01:19részletek
1042mariannkavei.huDrinkálné Papp Mariann2014-11-15 14:01:03részletek
1043marinagold.huGalaxis Világa Kft2014-11-20 19:01:08részletek
1044marketingido.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1045marketingstratega.huCT Consulting Central Europe Korlátolt Felelősségű Társaság2014-11-21 19:01:10részletek
1046masdamer.huFoodnet Kft.2014-11-21 19:01:18részletek
1047masdami.huFoodnet Kft.2014-11-21 19:01:17részletek
1048maspedlogisztika.huMasped Logisztika Logisztikai és Vámügynökségi Kft.2014-11-21 14:01:08részletek
1049masszazsterapiapecs.huHatházi Milán Attila2014-11-20 19:01:16részletek
1050masszorguru.huNothnágel Balázs2014-11-18 14:01:09részletek
1051masterbaits.huVeres Tamás E.v.2014-11-17 19:01:17részletek
1052masvagyok.huPapp Zsolt2014-11-17 14:01:21részletek
1053maszosz.huKrix Zoltán2014-11-19 19:01:08részletek
1054maszotars.huTájnel Gábor2014-11-17 19:01:11részletek
1055matiger.huElekes György2014-11-21 14:01:09részletek
1056matyasapartman.huPásztor Ádám2014-11-21 19:01:11részletek
1057meccskozpont.huKrix Zoltán2014-11-19 19:01:09részletek
1058medi-coach.huSzegény Beatrix2014-11-18 23:01:10részletek
1059medicalinvest.huGecsey Mihály2014-11-21 19:01:05részletek
1060medihol.huSzilágyi Informatika és Műszertechnika Kft.2014-11-17 19:01:07részletek
1061meditur.huAmber Industries Kft.2014-11-21 19:01:09részletek
1062meghatalmazas.huSántha György2014-11-22 23:01:02részletek
1063megoldasmediacio.huVégh János2014-11-17 19:01:22részletek
1064mentortext.huJanó Zoltán2014-11-17 19:01:06részletek
1065mercymolnar.huMolnár Ferenc2014-11-20 19:01:02részletek
1066merlinszalon.huWorld-System kft.2014-11-18 14:01:08részletek
1067mester-fok.huSzabó Attila2014-11-18 23:01:22részletek
1068mesterhegedu.huLakatos Anna2014-11-19 14:01:07részletek
1069metalenprint.hu"METALEN" Nyomdaipari és kereskedelmi Kft.2014-11-21 14:01:21részletek
1070meteobox.huAliaWeb, Spol. S R.o.2014-11-21 14:01:24részletek
1071meteospasmyl.huSager Pharma Kft.2014-11-18 19:01:07részletek
1072metropolcenter.huMetropol Center Kft2014-11-19 14:01:03részletek
1073mezohegyesszakkepzeseert.huSzumaszi Bt.2014-11-18 14:01:25részletek
1074mélytorok.huDiczkó Csaba2014-11-20 19:01:11részletek
1075mics.huMICS-LINE Szolgáltató Bt.2014-11-19 19:01:10részletek
1076mikroszoft.huMikroszoft Fejlesztő és Kereskedelmi Kft.2014-11-19 19:01:04részletek
1077milasslim.huMilassin András2014-11-17 19:01:13részletek
1078militariatrend.huRoth Tamás2014-11-17 19:01:02részletek
1079military-vadasz.huBojtor Tamás2014-11-20 19:01:19részletek
1080milwaukeeszerszam.huDL'1 Villamossági Nagykereskedés Kft2014-11-12 14:01:17részletek
1081mindenfoci.huSWA Szervíz Kft2014-11-17 19:01:07részletek
1082mindenholhal.huSzarvas-Fish Kft.2014-11-19 19:01:10részletek
1083mindenkönyv.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:12részletek
1084mineralmc.huRácz Mihály Zsolt2014-11-21 14:01:14részletek
1085miniapro.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
1086minifigures.huX-Software Kft.2014-11-21 14:01:26részletek
1087minosegiepites.huBertoja-Berend András2014-11-20 19:01:15részletek
1088misterspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1089mistyx.huCziráki Vilmos2014-11-21 19:01:17részletek
1090miswak.huWebsupport s.r.o.2014-11-19 19:01:19részletek
1091mlmhivatas.huZseli Csaba2014-11-20 19:01:05részletek
1092mmsklub.huKrix Zoltán2014-11-19 19:01:13részletek
1093mobilkutyu.huPC Webáruház Kft. 2014-11-18 14:01:22részletek
1094mobilsign.huMuhari Gábor2014-11-19 14:01:17részletek
1095mobsz.huIntegrasco Kft.2014-11-21 14:01:07részletek
1096modellking.huSzilágyi János2014-11-19 14:01:20részletek
1097moderndogfurniture.huVágner Adrienn2014-11-18 14:01:13részletek
1098modernkaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:05részletek
1099modernkonyveles.huAnger Tamás2014-11-21 14:01:28részletek
1100modernkutyabutor.huVágner Adrienn2014-11-18 14:01:10részletek
1101mogyorodiautosiskola.huHegedűs Vazul2014-11-19 14:01:16részletek
1102moire.huFinalArt Studio Kft.2014-11-19 14:01:12részletek
1103mojovibez.huFriendly Creative Agency Kft2014-11-19 23:01:02részletek
1104mokajenne.huAzonnal Kft.2014-11-17 19:01:21részletek
1105molnarmercy.huMolnár Ferenc2014-11-20 19:01:02részletek
1106moloetterem.huEuroDNS S.A.2014-11-17 14:01:22részletek
1107moltatech.huMOLTA-TECH Bt.2014-11-19 19:01:02részletek
1108momentsfilm.huKeszei Balázs2014-11-21 14:01:07részletek
1109mondoverde.huMondo Verde Casa & Giardino S.r.l.2014-11-21 23:01:04részletek
1110moneypay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
1111monimi.huSkodákné Krizsán Mónika2014-11-18 23:01:11részletek
1112monomuhely.huFinta Ferenc2014-11-21 19:01:06részletek
1113monostorikaposzta.huChrien Károly2014-11-19 14:01:03részletek
1114monstertrucks.huParamount Pictures International2014-11-19 23:01:11részletek
1115morelhifi.huPapp Zsolt2014-11-18 14:01:05részletek
1116mortofferoforras.huMortoff Kft.2014-11-21 19:01:14részletek
1117motiválódok.huGyeszát Zsolt2014-11-17 14:01:19részletek
1118motorosboltroadrider.huRoad Rider Kft2014-11-21 14:01:20részletek
1119movie-1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1120movie-one.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1121movie1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1122moviecool.huEuroCable Magyarorszag Kft.2014-11-16 19:01:04részletek
1123movieone.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1124moziegy.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
1125mozivan.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1126mrbitcoin.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1127mrspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1128mstyle.huSzabóné Molnár Mónika Éva2014-11-19 19:01:17részletek
1129mudi-suli.huBalázs Zsófia2014-11-17 14:01:05részletek
1130mueller-licht.huSysco-Lux Kft.2014-11-17 14:01:05részletek
1131muhely-titok.huFövenyi Györgyi2014-11-20 19:01:04részletek
1132mukoromzsele.huGombos Alex2014-11-19 19:01:18részletek
1133mulatosmiki.huHuncsik Ádám2014-11-18 19:01:02részletek
1134muller-licht.huSysco-Lux Kft.2014-11-17 14:01:06részletek
1135munkajogszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1136munkaruhamester.huHorváth Arszlán2014-11-19 14:01:16részletek
1137munkaruhanet.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1138munkavedelembiztonsag.huSeres Gyorgy2014-11-17 19:01:17részletek
1139munkavedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1140munzpeter.huMünz Péter2014-11-21 19:01:13részletek
1141museumhotel.huNext Kft.2014-11-17 19:01:07részletek
1142mvakolat.huMihucz Miklós e.v.2014-11-17 19:01:05részletek
1143mvhshop.hu True Trade Kft. 2014-11-20 14:01:02részletek
1144mvlvt.huSzatmári Szandra2014-11-20 14:01:12részletek
1145mxmphoto.huLovas Gábor2014-11-18 14:01:12részletek
1146mylan.co.huEuromarknet Kft. (Registrar)2014-11-18 14:01:02részletek
1147myrun.huWalter Ulrik2014-11-17 14:01:16részletek
1148mysticmoment.huSzabó Ákos2014-11-17 14:01:14részletek
1149mysticprod.huMystic Production Kft2014-11-17 14:01:06részletek
1150mythosetterem.huDP Consultingroup KFT2014-11-19 23:01:04részletek
1151nagy-ep.huNagy Gábor2014-11-17 14:01:22részletek
1152nagy-szulejman.huTrivium Kiadó Kft.2014-11-20 14:01:13részletek
1153nagycsaladosok-kondoros.huMegaweb kft2014-11-20 19:01:18részletek
1154nagyszulejman.huTrivium Kiadó Kft.2014-11-20 14:01:05részletek
1155nagyt0mi.huNagy Tamás2014-11-18 23:01:14részletek
1156nagytomi.huNagy Tamás2014-11-18 23:01:02részletek
1157nahungary.huTóth Gábor2014-11-17 14:01:02részletek
1158nanobikini.huPohl Veronika2014-11-20 19:01:07részletek
1159napellenzocentrum-gyor.huNapellenző Centrum Árnyékolástechnikai Kft. 2014-11-18 23:01:17részletek
1160napi-tender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
1161napifrissites.hu Taktikon Kft.2014-11-17 14:01:16részletek
1162napikaja.huKánya Loránd2014-11-20 14:01:03részletek
1163napiluxus.huFlick Zsuzsanna2014-11-21 14:01:17részletek
1164napitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:09részletek
1165napraforgo-kineziologia.huPRST-Invest Kft.2014-11-17 14:01:21részletek
1166napviragszappan.huConwell Kft.2014-11-20 14:01:13részletek
1167nasker.huINFO-FUNDA Betéti Társaság2014-11-20 14:01:07részletek
1168naszalymento.huViola Albert2014-11-20 19:01:03részletek
1169naszindito.huHatékony Konzultáns Kft.2014-11-20 14:01:11részletek
1170nativaszappan.huSchall Tamás2014-11-18 14:01:07részletek
1171naturdr.huVáradi Aranka2014-11-20 14:01:13részletek
1172navi-there.huVilágom Közepén Kft.2014-11-17 14:01:12részletek
1173navithere.huVilágom Közepén Kft.2014-11-17 14:01:14részletek
1174ncsk.huMegaweb kft2014-11-21 14:01:27részletek
1175neast.huIDEA BOX Kft2014-11-21 19:01:16részletek
1176nemalicit.huGelencsér Judit2014-11-18 14:01:14részletek
1177nemesfoto.huNemes Zoltán2014-11-19 14:01:07részletek
1178nemesvid.huNemesvid Község Önkormányzata2014-11-22 23:01:01részletek
1179nemetautodiszkont.huNémet Autódiszkont Kft.2014-11-17 14:01:18részletek
1180nemetiskola.huBambuk László2014-11-17 19:01:18részletek
1181nemettanfolyam.huSzigeti Ágnes2014-11-17 14:01:22részletek
1182nemzetiborbolt.huChateau Segesdi Kft.2014-11-20 14:01:13részletek
1183nemzetiminibus.huAM Logistic Kft. 2014-11-20 19:01:16részletek
1184nemzetiminibusz.huAM Logistic Kft. 2014-11-20 19:01:16részletek
1185neocasa.huHalla Krisztina2014-11-18 23:01:11részletek
1186neocast.huKis Mátyás2014-11-21 14:01:26részletek
1187neoworks.huBosnyák Péter2014-11-19 14:01:14részletek
1188nesteoil.huNESTE OIL OYJ2014-11-21 19:01:08részletek
1189neszmelyipalinka.huDomján Kft.2014-11-21 14:01:20részletek
1190nethazmester.huAradi László2014-11-20 19:01:05részletek
1191netika.huDr. Lázár Szabolcs2014-11-15 14:01:01részletek
1192netjogforras.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:03részletek
1193netjogtanacsado.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:23részletek
1194netkandallok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:22részletek
1195netkazanok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:23részletek
1196netniko.huNetniko Kft.2014-11-20 19:01:20részletek
1197netszakács.huUnger Tamás2014-11-19 23:01:03részletek
1198netvarium.huNetvarium.hu Kft.2014-11-18 14:01:14részletek
1199networkhost.huKerékgyártó József2014-11-19 14:01:15részletek
1200nevjegykartya-belyegzo.huPrádel Zsolt2014-11-21 19:01:04részletek
1201newera.huOlcsváry Rudolf2014-11-19 14:01:04részletek
1202newfacemarketing.huNagy Gábor2014-11-18 14:01:22részletek
1203némete-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
1204nfm.huSimia Alba Kft.2014-11-18 14:01:13részletek
1205ngmmotor.huNGM Motorfelújító Kft.2014-11-20 19:01:15részletek
1206nhir.huBaranczó Richárd2014-11-21 19:01:18részletek
1207nicebody.huNB Wellness Kft.2014-11-21 19:01:12részletek
1208nlksz.huWhitehall's Kft2014-11-17 19:01:18részletek
1209nobore.huNobore kft2014-11-18 23:01:07részletek
1210nokapalyan.huPéterfy-Novák Éva2014-11-18 19:01:04részletek
1211nophone.hueClick Apps Kft.2014-11-18 14:01:23részletek
1212nosztalgia-ajandek.huH Plusz P kereskedelmi és szolgáltató kft2014-11-21 19:01:10részletek
1213novalja.huVinko Róbert2014-11-17 19:01:17részletek
1214nsconsulting.hu Next Steps Consulting Kft.2014-11-17 14:01:09részletek
1215ntlaw.huEyegager Szolgáltató és Tanácsadó Korlátolt Felelősségű Társaság2014-11-17 14:01:17részletek
1216nuvita.huDevron-Impex Kft2014-11-19 14:01:18részletek
1217nyalás.huDiczkó Csaba2014-11-20 19:01:11részletek
1218nyákáruház.huHuszár Ádám2014-11-17 14:01:08részletek
1219nyelvtanfolyam-online.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:12részletek
1220nyeremenycenter.huVisual Media Kft.2014-11-18 23:01:08részletek
1221nyirvillany.huPátrovics Milán2014-11-17 19:01:18részletek
1222nyugdijgondoskodas.huMesszi-Szabó Gábor2014-11-19 19:01:15részletek
1223nyugdijhelyett.huErdős Nóra2014-11-17 14:01:24részletek
1224o-crypt.huINTEGRITY Kft.2014-11-21 14:01:24részletek
1225o3clean.huNezvál Gergely2014-11-19 14:01:17részletek
1226oatmealqueen.huGőkler András2014-11-19 14:01:03részletek
1227oazisstreaming.huOÁZIS Kkt.2014-11-18 14:01:04részletek
1228obucity.huAuto Securit Zrt.2014-11-19 14:01:11részletek
1229oceanjoga.huDr. Asztalos Attila2014-11-21 14:01:21részletek
1230oceanyoga.huDr. Asztalos Attila2014-11-21 14:01:17részletek
1231ocrypt.huINTEGRITY Kft.2014-11-21 14:01:13részletek
1232odango.huWebsupport s.r.o.2014-11-21 14:01:22részletek
1233odavan.huBaranczó Richárd2014-11-21 19:01:18részletek
1234office2office.huSzever Sebastian2014-11-21 14:01:11részletek
1235officefitness.huNémeti Zoltán2014-11-19 14:01:15részletek
1236ofgroup.huOpen Future Group Kft.2014-11-21 14:01:02részletek
1237oftn.huOrszágos Fejlesztési Tanácsadó Nonprofit Kft.2014-11-18 14:01:02részletek
1238oharom.huKrix Zoltán2014-11-19 19:01:12részletek
1239okosinstallácio.huLeme Kft2014-11-20 19:01:21részletek
1240okoskalandwebshop.huRigóné Plezsik Rita2014-11-20 14:01:08részletek
1241okoskutyuk.huGradinops Kft.2014-11-17 14:01:22részletek
1242okosmami.huDealhouse Kft.2014-11-21 14:01:03részletek
1243okosmerleg.huPromedtron Kft.2014-11-17 19:01:14részletek
1244okosnyomda.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:01részletek
1245okosvercukormero.huPromedtron Kft.2014-11-17 19:01:14részletek
1246okosvernyomasmero.huPromedtron Kft.2014-11-17 19:01:13részletek
1247olasze-egyetem.huKósz Csaba2014-11-18 14:01:08részletek
1248olcsodivatoscipo.huHáry Anikó2014-11-21 14:01:03részletek
1249oletv.huWebenlét Kft.2014-11-20 19:01:05részletek
1250onconsult.huQUAESTOR Pénzügyi Tanácsadó Zrt.2014-11-21 19:01:20részletek
1251onehundred.huE-LEVEN 2003 Kereskedelmi és Szolgáltató Kft.2014-11-19 19:01:18részletek
1252onemanbandmusic.huMészáros Zoltán 2014-11-18 23:01:13részletek
1253onenesscoffee.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1254online-kotes.huKecskés Zsolt2014-11-17 19:01:22részletek
1255online-uzlet.huGila Ádám2014-11-17 14:01:15részletek
1256onlinelove.huProfi Profil Nyelvstúdió KFT2014-11-21 14:01:12részletek
1257onlinemarketingtervezes.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1258onlinemarketingugynokseg.huMolnár Dániel Ders2014-11-19 19:01:15részletek
1259onlinemarketingügynökség.huMolnár Dániel Ders2014-11-19 19:01:01részletek
1260onlinemegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
1261onlinepizzeria.huGergely László Andras2014-11-20 19:01:21részletek
1262onniconsulting.huVértes Róbert2014-11-16 19:01:03részletek
1263opelbarta.huAutó Bartex Kft.2014-11-17 14:01:18részletek
1264openfuture.huOpen Future Group Kft.2014-11-21 14:01:02részletek
1265optikvarium.huBamaco Optik Kft.2014-11-21 14:01:21részletek
1266optimumhotels.huKlemm Balázs Lajos2014-11-16 19:01:01részletek
1267opuseteducatio.huHorváth Cz. János2014-11-20 19:01:22részletek
1268orange-oil.huDom West Kft2014-11-18 23:01:04részletek
1269orangeoil.huDom West Kft2014-11-18 23:01:05részletek
1270oriasmaci.huWisol Kft.2014-11-21 14:01:26részletek
1271oriasmuffin.huJónás Milán2014-11-19 19:01:03részletek
1272oriassuti.huJónás Milán2014-11-19 23:01:07részletek
1273ormeny-katolikus.huKövér István2014-11-21 14:01:23részletek
1274oror.huVízy András Miklós2014-11-21 19:01:14részletek
1275orosze-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
1276orsihaj.huMárkus Ágnes2014-11-15 14:01:02részletek
1277orszagospenztargepszovetseg.huNazza Software Kft.2014-11-17 14:01:13részletek
1278orvospenztargepek.huNazza Software Kft.2014-11-17 14:01:19részletek
1279osztalypenztar.huUnidomain Kft.2014-11-18 19:01:04részletek
1280oszter.huMidani Nizar2014-11-20 14:01:14részletek
1281otletvarazs.huFidus Company Bt2014-11-20 19:01:06részletek
1282ottbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1283otthoniuzlete.huUngár Ferenc2014-11-18 19:01:06részletek
1284otyliastyle.huSőrés Ottilia2014-11-19 19:01:21részletek
1285owhungary.huSk-Bau Kft.2014-11-17 14:01:15részletek
1286ozdfoto.huJancsurák Gábor2014-11-18 14:01:29részletek
1287ozoneclean.huNezvál Gergely2014-11-19 14:01:14részletek
1288p3t1.huVarga Péter2014-11-17 14:01:05részletek
1289packersvideotar.huSchmidtka László2014-11-17 19:01:03részletek
1290packplus.huDS Smith Packaging Hungary Kft2014-11-19 19:01:03részletek
1291pajerovalbamakoba.huDr. Szabó Kristóf2014-11-20 19:01:10részletek
1292paleopontpecs.huPabelo Kft.2014-11-17 19:01:13részletek
1293pamutharisnya.huÖko-PC Kft.2014-11-21 19:01:15részletek
1294pandajatek.huRévész László2014-11-20 14:01:11részletek
1295panelprogram2015.huDobonyi Valentina2014-11-18 14:01:27részletek
1296panniesbence.huSimonváros Katalin2014-11-21 23:01:03részletek
1297papinothpekseg.huPapinoth Sütőipari Kft2014-11-18 14:01:04részletek
1298papirekszer.huMéri Judit2014-11-18 14:01:22részletek
1299pappanikomira.huPapp Anikó Míra2014-11-22 23:01:01részletek
1300paradoxunion.huParadox Union Kft.2014-11-21 14:01:04részletek
1301parlagisasalapitvany.hu Parlagi Sas Alapítvány2014-11-19 14:01:09részletek
1302parokaplaza.huWeb-Zseb Kereskedelmi és Szolgáltató Bt.2014-11-17 14:01:19részletek
1303partytrendek.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1304pasreklam.huHorváth Attila 2014-11-21 19:01:15részletek
1305passionerie.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
1306patavafa.huVas János 2014-11-19 14:01:12részletek
1307patrol24.huPATROL24 Technologies Korlátolt Felelősségű Társaság 2014-11-21 14:01:06részletek
1308payaccounts.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1309paycoin.huGanyecz Gábor2014-11-20 14:01:07részletek
1310paycredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:10részletek
1311payin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
1312payout.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
1313paytransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1314pcstream.huDeák András László2014-11-21 19:01:02részletek
1315pcszervizszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
1316peabomedia.huWebsupport s.r.o.2014-11-21 14:01:03részletek
1317pecsert.huÖsszefogás Pécsért Egyesület2014-11-17 19:01:03részletek
1318pecsiingatlan.huRackhost Kft. (Registrar)2014-11-18 14:01:10részletek
1319pemco.huSCT Hungary Kft2014-11-19 19:01:16részletek
1320pemcoolaj.huSCT Hungary Kft2014-11-19 19:01:16részletek
1321pendienda.huÖKO-Technika Bt.2014-11-18 23:01:13részletek
1322pepemano.huBaracsi István2014-11-17 14:01:11részletek
1323pere-design.huPerényi Dániel2014-11-19 19:01:20részletek
1324perfectmind.huDemény Zsolt2014-11-17 19:01:04részletek
1325pesti-cola.huWalking Image Kft.2014-11-20 19:01:13részletek
1326pesticola.huWalking Image Kft.2014-11-20 19:01:03részletek
1327peterszalay.huSzalay Péter2014-11-18 23:01:13részletek
1328petmagic.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
1329petofiudszov.hu"Petőfi" Üdülőszövetkezet2014-11-19 14:01:03részletek
1330petrénypincészet.huSzabó Richárd András2014-11-18 14:01:25részletek
1331petzingercukraszat.huPetzinger Judit 2014-11-20 14:01:02részletek
1332pgpro.huWebsupport s.r.o.2014-11-16 19:01:07részletek
1333pgprof.huWebsupport s.r.o.2014-11-16 19:01:04részletek
1334phantomsmoke.huJoker Busz Travel Kft.2014-11-19 19:01:12részletek
1335pharmekal.huWell-Form Kft.2014-11-20 19:01:06részletek
1336philae.huPohl Veronika2014-11-17 19:01:08részletek
1337pic-studio.huGyőrfi András2014-11-20 19:01:09részletek
1338pillaeskorom.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:06részletek
1339pillanatom.huSzabó Gábor2014-11-18 14:01:03részletek
1340pillangocsoport.huAlacs Edina2014-11-19 14:01:06részletek
1341pillemano.huErdész-Márkus Anita2014-11-19 14:01:10részletek
1342pinkrock.huPink Rock Investor Relations Kft.2014-11-19 19:01:16részletek
1343pirotlaszlo.huPirót Ádám2014-11-21 14:01:30részletek
1344pizza112.huTóth Rudolf2014-11-21 14:01:04részletek
1345pizzasprintmiskolc.huBrógli Máté2014-11-17 14:01:08részletek
1346plac.huM&D Holding Kft2014-11-18 23:01:23részletek
1347plancal.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:04részletek
1348plastidip-shop.huFlyR Reklámműhely kft2014-11-20 19:01:11részletek
1349plastinvest.huKurán Antal2014-11-18 14:01:20részletek
1350plat.huNádasdy András2014-11-15 14:01:02részletek
1351plazainformacio.huInternet Strategy International Kft.2014-11-17 19:01:01részletek
1352pofonfutar.huV8 IT & MEDIA Kft.2014-11-21 14:01:14részletek
1353pointsofyou.huD-LAB Consulting Kft.2014-11-20 14:01:11részletek
1354polelites.huSzabó Szilárd2014-11-21 23:01:03részletek
1355pomiversum.huKozalik Attila2014-11-20 19:01:02részletek
1356ponstrik.huPONSTRIK Korlátolt Felelősségű Társaság2014-11-20 14:01:10részletek
1357pontapps.huPont Systems Zrt.2014-11-20 19:01:16részletek
1358pontefilm.huQUAESTOR Pénzügyi Tanácsadó Zrt.2014-11-21 19:01:12részletek
1359poo-pourri.huSeducanto s.r.o.2014-11-19 19:01:06részletek
1360pornósztárok.huDiczkó Csaba2014-11-21 14:01:19részletek
1361pos-digital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
1362posdigital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
1363pospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
1364postpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1365potgazdi.huOlma Gabriella2014-11-18 23:01:04részletek
1366prc-product.huKovács András2014-11-17 14:01:24részletek
1367premiumbrikett.huS and P Trucks Kft2014-11-20 14:01:06részletek
1368premiumchocolate.huGEO-13 KFT.2014-11-21 14:01:22részletek
1369premiumtanacsadas.huTörkő Zsolt2014-11-21 14:01:06részletek
1370prenome.huCene Judit2014-11-19 19:01:17részletek
1371primaweb.huUlicska Tamás2014-11-21 19:01:10részletek
1372primusaqua.huBonaventura Gold Kft2014-11-17 14:01:18részletek
1373printnet.huPrintnet Kft. 2014-11-21 19:01:20részletek
1374prixa.huPausch Rita2014-11-19 19:01:20részletek
1375probaljki.huPannon-Servus Kft.2014-11-18 23:01:24részletek
1376probiotikum-blog.huVitaminKosár Kft.2014-11-20 19:01:21részletek
1377probiotikumblog.huVitaminKosár Kft.2014-11-20 19:01:17részletek
1378profitisztitas.huUnidomain Kft.2014-11-17 19:01:05részletek
1379profitnavigator.huDiamond Books Kft.2014-11-17 19:01:03részletek
1380progeo.huRépás Zoltán2014-11-21 19:01:07részletek
1381project2501.huKlenóczki Norbert2014-11-18 23:01:15részletek
1382projektangyal.huEUROPROJEKT EGER Kft.2014-11-20 14:01:06részletek
1383proksasef.huBrankovics Gábor 2014-11-21 19:01:08részletek
1384promedica.huB-ALL-MED Bt.2014-11-19 23:01:06részletek
1385promedica24.huDr. Gajdics Gábor2014-11-21 14:01:03részletek
1386protokoll-beszerzes.huMajor Roland2014-11-17 23:01:01részletek
1387providss.huProvid Special Service Kft.2014-11-18 14:01:02részletek
1388proxyszerver.hueForce Informatikai és Kereskedelmi Kft.2014-11-19 19:01:21részletek
1389pszbacs.huKrix Zoltán2014-11-20 14:01:12részletek
1390ptewebprint.huBalla Dávid2014-11-18 23:01:12részletek
1391pulsarium.huKollár István2014-11-18 23:01:03részletek
1392pure.huUnidomain Kft.2014-11-21 19:01:05részletek
1393pureleverage.huWebsupport s.r.o.2014-11-20 19:01:19részletek
1394puskelzsolt.huPuskel Zsolt2014-11-21 14:01:10részletek
1395pvctech.huPVC-TECH Ipari, Kereskedelmi és Szolgáltató Kft.2014-11-21 19:01:06részletek
1396qualitytrading.huQuality Trading Bt.2014-11-18 14:01:28részletek
1397quick24.huUgocean Janos Peter Persoana Fizica Autorizata2014-11-21 19:01:13részletek
1398radio1gyor.huSzakos Péter2014-11-18 19:01:08részletek
1399radioaktivpecs.huKrix Zoltán2014-11-19 19:01:22részletek
1400rakodogepberles.huSzatmári Róbert2014-11-21 14:01:22részletek
1401raktar-guru.huPethő Eszer2014-11-20 14:01:08részletek
1402raktaroid.huPickermann Adél2014-11-19 14:01:14részletek
1403randivideo.huNoname Domain Kft.2014-11-18 23:01:06részletek
1404raspartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1405ravenololaj.huSCT Hungary Kft2014-11-19 19:01:17részletek
1406reality-property.co.huReality-property Kft2014-11-21 14:01:29részletek
1407rean.huAnger Tamás2014-11-21 14:01:28részletek
1408redony-satoraljaujhely.huRutai Sándor2014-11-21 14:01:13részletek
1409redony-szerencs.huRutai Sándor2014-11-21 14:01:12részletek
1410redonyerd.huRutai Sándor2014-11-17 14:01:06részletek
1411redoxcsoport.huEszik Marianna2014-11-18 14:01:27részletek
1412reduline-36.huW-BUSINESS S. R. O.2014-11-21 19:01:12részletek
1413refiper.huCserháti Ferenc2014-11-19 14:01:11részletek
1414regenexa.huDr. Bábel Béla Tamás2014-11-17 14:01:03részletek
1415regisegekpiaca.huKérai Gusztáv2014-11-17 19:01:06részletek
1416regisztracios-ado.huKovács Péter2014-11-20 19:01:22részletek
1417regkft.huReal Estate & Garden Solutions Kft.2014-11-20 19:01:22részletek
1418rehatechnika.huReha-Technika Kft.2014-11-20 19:01:18részletek
1419reli.huHettich Zsolt2014-11-19 23:01:11részletek
1420rendezvenyguru.huMillennium International Kft.2014-11-17 19:01:03részletek
1421rendszergazdaszolnok.huADACSA Kft.2014-11-18 14:01:09részletek
1422rendy.huRendes Gábor E.V.2014-11-20 14:01:05részletek
1423reneszanszajandek.huReneszánsz Panoptikum Kft.2014-11-19 14:01:16részletek
1424rentallcar.huPálvölgyi Gábor2014-11-17 19:01:18részletek
1425repulogepemlekpark.huKrix Zoltán2014-11-19 19:01:13részletek
1426repulospajz.huFarkas Andrea2014-11-19 14:01:16részletek
1427restauratorart.huGyöpös Viktória2014-11-18 23:01:23részletek
1428reszletre.huBártfai Balázs2014-11-18 14:01:02részletek
1429retailhungary.huMajor Krisztina e.v.2014-11-19 19:01:12részletek
1430revelar.huNaturemed Kft2014-11-17 14:01:10részletek
1431revkft.huRÉV Kft.2014-11-19 14:01:16részletek
1432rezsinullazo.huRubi Consulting Kft.2014-11-21 19:01:12részletek
1433régiségekpiaca.huKérai Gusztáv2014-11-18 14:01:22részletek
1434rfb.huUnidomain Kft.2014-11-17 14:01:01részletek
1435ricamente.huRicamente Kft.2014-11-18 14:01:09részletek
1436rina.huCarina Novum Kft.2014-11-21 14:01:18részletek
1437ringieraxelspringerpartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1438rinity.huSzabó Károly2014-11-18 14:01:29részletek
1439ritanti.huTóthné Herner Rita2014-11-18 14:01:16részletek
1440ritauzlethaz.huIMMOWIT Kft.2014-11-19 14:01:14részletek
1441rkelenyiangelika.huPublish and More Kft.2014-11-21 19:01:09részletek
1442roachy.huRozsnyai Zsolt2014-11-18 14:01:18részletek
1443roadruner.huAlcuin Schola Kft.2014-11-17 14:01:09részletek
1444roboroom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1445roboshop.huRobotguru Kereskedőház Kft.2014-11-17 19:01:07részletek
1446robotest.huRobotguru Kereskedőház Kft.2014-11-17 19:01:09részletek
1447robotv.huRobotguru Kereskedőház Kft.2014-11-17 19:01:06részletek
1448robozoom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1449rockmunkavedelem.huMolnár és Társa Kft.2014-11-17 14:01:22részletek
1450rockpub.huDoor2World Bt.2014-11-18 23:01:12részletek
1451rockpubcafe.huDoor2World Bt.2014-11-18 23:01:12részletek
1452rocksafety.huMolnár és Társa Kft.2014-11-17 14:01:21részletek
1453roku.huEuroCable Magyarorszag Kft.2014-11-20 19:01:16részletek
1454rolandkis.huKis Roland2014-11-20 19:01:11részletek
1455romaipartihirek.huRSE Római Part Nonprofit Kft.2014-11-20 19:01:04részletek
1456romanticgardrob.huSiposné Geschitz Annamária e.v.2014-11-20 14:01:16részletek
1457romerautosules.huBaba-Ker Kft2014-11-17 14:01:04részletek
1458roncs-licit.huSzugyiczki András2014-11-20 14:01:03részletek
1459roncsautoaukcio.huSzugyiczki András2014-11-20 14:01:03részletek
1460rovarcsapdaaruhaz.huBLA-TOX Kft2014-11-21 14:01:28részletek
1461rovarcsapdashop.huBLA-TOX Kft2014-11-21 14:01:03részletek
1462ruha-webshop-info.huMódium Divatház Kft.2014-11-21 19:01:03részletek
1463ruhaklinika.huMens Wear Kft.2014-11-18 19:01:05részletek
1464sajticsaba.huSajti Csaba2014-11-17 19:01:17részletek
1465sajtosport.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1466salatagyar-eletmod-shop.huFITTBÁZIS Életmód Bt.2014-11-19 14:01:21részletek
1467saleandbuy.huGEO-13 KFT.2014-11-21 14:01:21részletek
1468samsonline.huVarga János2014-11-20 19:01:12részletek
1469saniflex.huGecsey Mihály2014-11-21 14:01:14részletek
1470sanpaolo.huKoffein-Futár Kft.2014-11-19 23:01:06részletek
1471sarahazavendeghaz.huHerczeg Krisztina2014-11-19 19:01:19részletek
1472saturdays.huKovács Balázs2014-11-17 14:01:14részletek
1473schonecker.huBARBER ART KFT2014-11-21 19:01:09részletek
1474schwarczattila.huDr. Schwarcz Attila2014-11-19 23:01:12részletek
1475scoliosisterapia.huHolcsa Judit2014-11-18 14:01:06részletek
1476scop.huCOP Rendszertechnika Kft.2014-11-19 19:01:22részletek
1477seeoo-cvikker.huGravitas B.V.Á. Kft.2014-11-21 23:01:03részletek
1478selfibot.huVeres Tamás2014-11-18 14:01:17részletek
1479selfiepalca.huVeres Tamás2014-11-18 14:01:18részletek
1480selfipalca.huVeres Tamás2014-11-18 14:01:23részletek
1481sensationstyling.huSensation Styling Kft2014-11-19 14:01:13részletek
1482sexdating.huKrix Zoltán2014-11-19 19:01:07részletek
1483sextopbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:18részletek
1484shenzeneurope.huPusztai József Tamás2014-11-21 14:01:21részletek
1485shoppingvin.huDolphinet Kft.2014-11-17 14:01:18részletek
1486shoppingwin.huDolphinet Kft.2014-11-17 14:01:11részletek
1487signalshop.huFerunio 95 Kft.2014-11-18 14:01:30részletek
1488silentmusic.huCyclick Kft.2014-11-19 23:01:07részletek
1489sillyfaceoff.huEuromarknet Kft. (Registrar)2014-11-21 14:01:29részletek
1490silux.huWebenlét Kft.2014-11-16 19:01:03részletek
1491simonhantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:13részletek
1492simplexpalyazat.huHorváth Ádám2014-11-21 14:01:06részletek
1493sipostibor.huSipos Tibor2014-11-19 19:01:10részletek
1494sipper.huSipper Transport Kft. 2014-11-18 14:01:24részletek
1495sj4000sportkamera.huElectropoint Kft.2014-11-18 23:01:11részletek
1496skydoorshop.huHorváth Roland László E.V.2014-11-17 14:01:24részletek
1497skyflytravel.huZ+T Bt.2014-11-18 14:01:04részletek
1498skypeprofesszor.huSztolár Miklós2014-11-17 19:01:20részletek
1499sleader.huRózsa Péter2014-11-19 14:01:03részletek
1500sleepingbeauty.huRéti Enikő2014-11-21 19:01:16részletek
1501smartinstall.huSmart Install Kft.2014-11-19 14:01:13részletek
1502smartpay.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
1503smtp-szerver.huIT-Nav Hungary Kft2014-11-21 23:01:03részletek
1504socialmarket.huImex Global Kft.2014-11-21 19:01:12részletek
1505sodrasszalon.hu2GP Kft2014-11-17 19:01:06részletek
1506sofilux.huSofilux Kft.2014-11-20 19:01:11részletek
1507soft-telekom.huSoft-Dekor Kft2014-11-18 23:01:03részletek
1508softskillsinit.huSzabó Csaba2014-11-21 19:01:14részletek
1509softwarecraftsmanship.huAndó Művek Korlátolt Felelősségű Társaság2014-11-18 14:01:06részletek
1510somatodrol.huJPT Investment Partners Limited2014-11-21 19:01:02részletek
1511somlomuvek.huZs. Somló Krisztián2014-11-21 19:01:03részletek
1512sopronibolcsodek.huBökönyi Norbert EV.2014-11-20 19:01:13részletek
1513soproniingatlan.huKrix Zoltán2014-11-19 19:01:11részletek
1514sorkatonavoltam.huMihályi Produkció KFT.2014-11-21 14:01:25részletek
1515sorozatvago.huIwood Kft.2014-11-20 19:01:17részletek
1516sorsfutar.huRatkai Dávid2014-11-19 14:01:09részletek
1517soszoba-sopron.huKerékgyártó Kereskedelmi és Szolg. Bt.2014-11-18 14:01:08részletek
1518spanyole-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
1519specops.huSpecops Hungary Kft.2014-11-19 14:01:09részletek
1520speed-fittness.huVér József2014-11-19 19:01:05részletek
1521speedtruckservice.huSpeed Truck Service Kft.2014-11-18 14:01:30részletek
1522spineartgyogytorna.huHolcsa Judit2014-11-18 14:01:09részletek
1523spinnerszek.huSpinner Kerekesszék Gyártó Kft.2014-11-17 14:01:07részletek
1524spiphone.huSPInet Magyarország Kft.2014-11-21 14:01:05részletek
1525spiritfitness.huSisák Zoltán2014-11-19 19:01:20részletek
1526sportmotivacio.huNyomárkay András2014-11-19 23:01:10részletek
1527sportoutletshop.huKatona Dániel2014-11-19 19:01:21részletek
1528sportpalace.huZsorja Sport Kft. 2014-11-21 14:01:19részletek
1529srff.huPortoLogic Kft2014-11-17 14:01:10részletek
1530srichinmoykonyvek.huMadal Bal Kft2014-11-21 19:01:09részletek
1531sslland.hu23VNET Kft. (Registrar)2014-11-21 19:01:05részletek
1532stadionguide.huElender 2000 Kft2014-11-18 14:01:17részletek
1533stadionkalauz.huElender 2000 Kft2014-11-18 14:01:17részletek
1534startlapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1535startupdomain.huMonitor Média Kft.2014-11-20 14:01:06részletek
1536startupkft.huStart Up Kft.2014-11-20 19:01:11részletek
1537startupp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1538startupsuli.huLauritzen Instore Kft.2014-11-21 14:01:14részletek
1539stilusesdivat.huRiczkó István2014-11-17 14:01:24részletek
1540stoneenergykft.huStone Energy Kft2014-11-17 14:01:05részletek
1541styleboutique.huBalla Tibor2014-11-18 14:01:26részletek
1542sungardenszalon.huNeusch Csaba2014-11-18 23:01:14részletek
1543sungardenszolarium.huNeusch Csaba2014-11-19 19:01:14részletek
1544sunrisebeachhungary.huSzabó Tibor2014-11-21 23:01:04részletek
1545sunrisehosting.huBuzás Péter2014-11-16 19:01:05részletek
1546sunstrip.huTürk Sára2014-11-21 19:01:07részletek
1547superoutlet.huKészlet-Fészek Bt.2014-11-21 19:01:19részletek
1548superworld.hu Dora-Land Kft.2014-11-17 14:01:15részletek
1549sushibar.huPADOS PIPI Kereskedelmi Betéti Társaság2014-11-21 19:01:11részletek
1550sutimegen.huWebsupport s.r.o.2014-11-17 19:01:22részletek
1551sutizz.huSomlyódy-Gerő Eszter2014-11-16 19:01:06részletek
1552suznvilaga.huHujber Zsuzsanna2014-11-21 19:01:12részletek
1553swaszervizkft.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1554swconsulting.huST devices Bt.2014-11-17 19:01:12részletek
1555sweethairwebshop.huHorváth Bíborka2014-11-17 19:01:08részletek
1556swimmingerd.huÉrdi Úszó Sport Kft2014-11-15 14:01:03részletek
1557swine.huRadnai László2014-11-18 23:01:11részletek
1558sxi.sport.huPreisinger Gábor2014-11-16 19:01:07részletek
1559sylviapartner.huBardovics Bt2014-11-19 23:01:07részletek
1560symbolonintezet.huQS 2000 Bt.2014-11-17 19:01:18részletek
1561syncovery.huVE-Matéria Kft.2014-11-17 19:01:06részletek
1562szablyavivas.huBalogh Attila2014-11-19 14:01:15részletek
1563szaboestsa.huGyapiNet Bt.2014-11-18 23:01:02részletek
1564szaboking.huSzabó Tibor2014-11-19 23:01:07részletek
1565szakalyjanos.huSzakály János2014-11-17 19:01:10részletek
1566szakikereso.huFilep Józsefné2014-11-17 14:01:02részletek
1567szakmaicegbazis.huMiszlai-Holdosi Henrietta2014-11-18 14:01:11részletek
1568szakmaktalalkozoja.huEVADO Kft.2014-11-15 14:01:03részletek
1569szakmattanulok.huJózanné Sipos Etelka2014-11-18 14:01:21részletek
1570szallodaknapja.huEuroDNS S.A.2014-11-17 14:01:17részletek
1571szameg.huVégh Máté2014-11-21 14:01:20részletek
1572szamitogep-laptopszerviz.huP-norton Kft.2014-11-17 14:01:19részletek
1573szamocahaz.huSzabó Mónika2014-11-20 19:01:16részletek
1574szamocakozpont.huSzabó Mónika2014-11-20 19:01:14részletek
1575szamocapedagogia.huSzabó Mónika2014-11-20 19:01:05részletek
1576szamvitelszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1577szanyizsolt.huSzanyi Zsolt2014-11-21 14:01:16részletek
1578szaszabutik.huPataki Szandra Mária2014-11-21 14:01:15részletek
1579szaszamotorsport.huSzabó Gábor2014-11-21 19:01:10részletek
1580szatmaroffice.huElektrix Rendszerház Kft2014-11-21 19:01:06részletek
1581szatyika.huSzathmári József2014-11-17 14:01:04részletek
1582szekesfehervarfogaszat.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:21részletek
1583szelfiebot.huVeres Tamás2014-11-18 14:01:23részletek
1584szelfiepalca.huVeres Tamás2014-11-18 14:01:23részletek
1585szelfipalca.huVeres Tamás2014-11-18 14:01:23részletek
1586szemelyesatvetelipont.huManda Kft.2014-11-18 14:01:11részletek
1587szemelyiedzok.huBatyi Béla2014-11-17 19:01:20részletek
1588szemle.huBelvedere Meridionale Kft.2014-11-19 14:01:02részletek
1589szenioreletmod.huLesko Márk2014-11-19 19:01:16részletek
1590szentmiklosparkfalu.huJUKO Kft.2014-11-19 14:01:14részletek
1591szepnapok.huErdős Nóra2014-11-17 14:01:11részletek
1592szerelemlakatgyar.huCzövek Róbert2014-11-21 19:01:08részletek
1593szeretetpiac.huRadnay Péter2014-11-17 14:01:03részletek
1594szerviz7.huSzűcs József2014-11-21 19:01:12részletek
1595szexshop-hungary.huKrix Zoltán2014-11-19 19:01:07részletek
1596szieglpince.huSziegl Családi Pince Kft.2014-11-21 14:01:10részletek
1597szikrasecurity.huKisari Ádám2014-11-20 19:01:14részletek
1598szingli-fesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
1599szinglifesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
1600szinpadom.huHorváth Ferenc2014-11-21 19:01:19részletek
1601szip-map.hueNET Internetkutató és Tanácsadó Kft.2014-11-20 19:01:22részletek
1602sziviszovi.huIT DEPO Kft.2014-11-19 23:01:09részletek
1603színpadom.huHorváth Ferenc2014-11-21 19:01:09részletek
1604szocialisdepo.huMajoros Márta2014-11-20 19:01:10részletek
1605szocstamas.huDr. Szőcs Tamás2014-11-18 14:01:07részletek
1606szolnoketterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:09részletek
1607szolnoktar.huVerseghy Ferenc Könyvtár és Közművelődési Intézmény2014-11-19 14:01:10részletek
1608szombathelyigamesz.huSzombathelyi Köznevelési GAMESZ 2014-11-21 14:01:17részletek
1609szonyegekonline.huSakina-Textile Kft2014-11-18 14:01:25részletek
1610szopás.huDiczkó Csaba2014-11-20 19:01:08részletek
1611szulejmán.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1612szulinapra2010.huTarján Tibor2014-11-17 19:01:11részletek
1613tabletnyomda.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1614tabletpenztargep.huNazza Software Kft.2014-11-20 14:01:14részletek
1615tagikolcson.huSilicium Network Informatikai Kft.2014-11-21 14:01:24részletek
1616taichi-mindenkinek.huAnonymouse Domains s.r.o.2014-11-18 14:01:29részletek
1617takacszsolt.huTakács Zsolt EV2014-11-18 14:01:11részletek
1618talizmansport.huPapp Jánosné2014-11-17 14:01:19részletek
1619tallinder.huLPP S.A.2014-11-17 14:01:05részletek
1620tallinton.huLPP S.A.2014-11-17 14:01:05részletek
1621tamaratorna.huST Art & Web Kft.2014-11-17 14:01:23részletek
1622tapetafutar.huÁrvai Sándor2014-11-17 19:01:19részletek
1623tapetanagyker.huKutasi-Vilsitz Kft2014-11-17 19:01:16részletek
1624taplalkozastudomany.huPankotai-Nagy Nóra Lívia2014-11-17 14:01:12részletek
1625targoncaforum.huHÓD-Agroszer Kft.2014-11-18 14:01:26részletek
1626tarpahill.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
1627tarsalkodok.huPásztor László2014-11-18 23:01:10részletek
1628tarsashazepito.huBertoja-Berend András2014-11-20 19:01:03részletek
1629taskacarp.huWebsupport s.r.o.2014-11-19 23:01:11részletek
1630tavaszizene.huTatabányART Művészeti Egyesület2014-11-18 14:01:06részletek
1631taxinvestment.huTax Investment Kft.2014-11-19 23:01:03részletek
1632taxismart.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
1633taylors.huTaylors Fashion Korlátolt Felelősségű Társaság2014-11-21 14:01:26részletek
1634tcg-global.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:21részletek
1635tcgglobal.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:15részletek
1636teaacademy.hu Sólámpás Kft.2014-11-17 14:01:18részletek
1637teaworld.huKamala Kft.2014-11-19 14:01:04részletek
1638techcentral.huTechcentral Kft.2014-11-17 14:01:10részletek
1639technosport.huKrix Zoltán2014-11-19 19:01:02részletek
1640teenbuilding.huNetkorzo Online Szolgáltató Kft2014-11-21 14:01:16részletek
1641teglasjohanna-webdesign.huTéglás Johanna2014-11-20 14:01:14részletek
1642teisfoundation.huTegyünk Együtt az Ifjúságért Alapítvány2014-11-21 14:01:19részletek
1643telekomwebshop.huDutel Kft. 2014-11-10 14:01:23részletek
1644teljeselmesalkotas.huBihari László2014-11-19 19:01:06részletek
1645tenderhirek.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
1646teneues.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
1647terapia-gyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
1648terapiagyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:10részletek
1649termekmatrica.huFülöp Attila2014-11-21 19:01:17részletek
1650termeloimezpiac.huMakács Zoltán2014-11-17 19:01:12részletek
1651teszi.huTESZI Szent György Központ2014-11-21 14:01:14részletek
1652tesztapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1653tetofedes-kaposvar.huRutai Sándor2014-11-20 19:01:07részletek
1654thermoline.huTHERMO LINE Mérnöki Kft.2014-11-21 14:01:07részletek
1655thetateremtes.huNagy Enikő2014-11-21 14:01:10részletek
1656tibekacnc.huTibeka-Design Kft2014-11-19 23:01:11részletek
1657tibysoft.huMészáros Tibor2014-11-18 14:01:22részletek
1658tiensszombathely.huTakács László2014-11-17 14:01:25részletek
1659tietokone.huTietokone Kft.2014-11-19 14:01:08részletek
1660timiesantal.huVarga Norbert2014-11-20 19:01:05részletek
1661tinipornó.huDiczkó Csaba2014-11-21 14:01:30részletek
1662tiszariver.huKrix Zoltán2014-11-19 19:01:13részletek
1663tiszatrade.huTISZA-TRADE KFT2014-11-18 14:01:28részletek
1664tisztatarsashaz.huSzabó Péter2014-11-18 14:01:28részletek
1665tizenketto.huKő Tamás2014-11-17 14:01:20részletek
1666tnno.huAdminSYS Kft.2014-11-18 14:01:03részletek
1667tocsport.huPartner Kft.2014-11-21 14:01:09részletek
1668todayslook.huHostnet bv2014-11-18 14:01:27részletek
1669toltoanyag.huDunaCom Plus Kft.2014-11-19 19:01:02részletek
1670tomascooksport.huPartner Kft.2014-11-21 14:01:09részletek
1671tombsajt.huFoodnet Kft.2014-11-21 19:01:17részletek
1672tomitextil.huMaszlag Tamás2014-11-17 19:01:20részletek
1673top10radio.huElek Imre2014-11-18 23:01:03részletek
1674topacel.huTop Acél Kft.2014-11-20 19:01:19részletek
1675topapartman.huBluecast Kft. (Registrar)2014-11-17 19:01:16részletek
1676tothgabriella.huTóth Gabriella2014-11-17 19:01:19részletek
1677toyota-budapest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1678toyota-frey.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
1679toyota-pest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1680toyota-szalon.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
1681toyotacenter.huEmil Frey Magyarország Kft2014-11-18 14:01:15részletek
1682toyotazuglo.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1683tömbsajt.huFoodnet Kft.2014-11-21 19:01:17részletek
1684train4gain.huTrainforgain Kft2014-11-19 19:01:05részletek
1685trainingcamphungary.huHírös Sport Szabadidő Létesítményeket Működtető és Szolgáltató Kft2014-11-21 19:01:06részletek
1686traktortrade.huTraktor Trade Kft2014-11-18 23:01:15részletek
1687transzfer-eger.huDONUCS SPEED Bt.2014-11-18 14:01:16részletek
1688travelchef.huAgrocorp Consulting Kft2014-11-21 14:01:12részletek
1689trenditv.huEuroCable Magyarorszag Kft.2014-11-17 14:01:20részletek
1690trinomkft.huTRINOM Kft.2014-11-18 14:01:23részletek
1691trofeaebed.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:07részletek
1692trófeaebéd.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:06részletek
1693truehosting.huBakos Attila2014-11-15 14:01:04részletek
1694turbointercooler.huDomokos Péter2014-11-20 19:01:12részletek
1695turoczibarna.huTuróczi Barnabás2014-11-21 23:01:03részletek
1696tuzepbolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
1697tuzepshop.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
1698tuzifagyar.huIwood Kft.2014-11-18 19:01:01részletek
1699tuzraktar.huClub-Mate Hungary Kft.2014-11-21 14:01:27részletek
1700tuzvedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1701tvcool.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1702tvjegy.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1703typhoontrade.huSzeles Szabolcs2014-11-19 23:01:06részletek
1704ubmmedica.huKrix Zoltán2014-11-19 19:01:08részletek
1705ugytar.huBroadBit Hungary Kft.2014-11-20 19:01:07részletek
1706ugyved-katalogus.huKányási Péter2014-11-18 14:01:20részletek
1707ugyvedadatbazis.huLawmatch Tanácsadó és Szolgáltató Korlátolt Felelősségű Társaság2014-11-21 14:01:23részletek
1708ugyvedegyesulet.huMagyar Ügyvédek Egyesülete2014-11-18 14:01:21részletek
1709ugyveditudastar.huMenedzser Praxis Kft.2014-11-18 14:01:02részletek
1710ugyvedmiskolc.hudr Harsányi Ádám Marcell2014-11-19 14:01:11részletek
1711ujrendszervaltas.huNoname Domain Kft.2014-11-18 23:01:22részletek
1712ujszilvasiskola.huTápiószőlős-Újszilvás Ref. Ált. Isk. és Óvoda2014-11-19 19:01:12részletek
1713uknow.huJaczkó Róbert Gyula EV2014-11-21 19:01:20részletek
1714ulogarnitura-albadivani.huHorizonet Kft. 2014-11-17 19:01:04részletek
1715ultetokartya.huIkeszep Bt.2014-11-18 14:01:12részletek
1716unico.huKrix Zoltán2014-11-20 14:01:11részletek
1717unitedline.huKovács Miklós2014-11-18 23:01:10részletek
1718universalmedia.huKnapp Dávid2014-11-18 19:01:03részletek
1719upmicro.huKrix Zoltán2014-11-19 19:01:10részletek
1720urbanpm.huAdacta Systems Kft.2014-11-20 19:01:03részletek
1721uresbeszed.huErdős Nóra2014-11-17 14:01:14részletek
1722usfsbudapesthomes.huKudelász Balázs2014-11-18 14:01:15részletek
1723uttern.huGrassland Kft2014-11-17 19:01:19részletek
1724uvegfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:02részletek
1725uvegfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:22részletek
1726uzletekpapa.huStone-Press Bt.2014-11-18 14:01:10részletek
1727uzletiajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
1728v8.forum.huV8 IT & MEDIA Kft.2014-11-21 14:01:13részletek
1729vabrikpaintball.huVabrik és Fia Kft2014-11-17 19:01:10részletek
1730vacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
1731vacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
1732vacskamati.huSári Márton2014-11-20 19:01:04részletek
1733vakkancskozmetika.huJuhász András2014-11-21 14:01:10részletek
1734valentinra.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
1735valentinre.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1736valiszepseg.huSzoboszlay András2014-11-17 14:01:14részletek
1737valmontkontroll.huSzabó József EV.2014-11-18 14:01:25részletek
1738vanilia123.huLászló Éva2014-11-17 14:01:23részletek
1739vanillaworks.huJózsef Adrienn2014-11-18 14:01:03részletek
1740varazshangulat.huPilling Tünde2014-11-19 14:01:12részletek
1741varoslodiovoda.huHegyi Attila2014-11-17 14:01:11részletek
1742vasivizszereles.huSákovics Bence 2014-11-21 19:01:08részletek
1743vasscsalad.huVass Bence2014-11-17 14:01:23részletek
1744vastalanito.huFürjesi Bálint2014-11-20 14:01:12részletek
1745vasutihid.huKrix Zoltán2014-11-19 19:01:07részletek
1746vcoin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:20részletek
1747vcredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1748veddaszarnyaidala.huACG Reklámügynökség Kft.2014-11-19 19:01:22részletek
1749vedoszarny.huACG Reklámügynökség Kft.2014-11-19 19:01:02részletek
1750veganelet.huBiztos Holnap szociális szövetkezet2014-11-17 19:01:02részletek
1751vegasburger.huHolló Zsuzsanna2014-11-19 14:01:19részletek
1752velenceistukko.huSipőcz Kft.2014-11-20 19:01:12részletek
1753velenceitavieskuvo.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
1754velenceitavieskuvok.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
1755vendeglatoingatlanok.huHiker 2000 Bt.2014-11-18 14:01:08részletek
1756vengerka.huVesogama Kft.2014-11-21 19:01:13részletek
1757verbaline.huVerbaline Kft.2014-11-20 19:01:15részletek
1758verticalinverse.huSzénási Levente2014-11-19 23:01:05részletek
1759vgeotechnika.huVincze-Gál Geotechnika Bt.2014-11-18 23:01:04részletek
1760viaferrata-dolomitok.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:10részletek
1761viaferrata-garda-to.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:20részletek
1762viaferrata-rax.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:22részletek
1763vibratorextra.huIllés Krisztina2014-11-21 14:01:21részletek
1764vicavirag.huÁbrahám Éva E.V.2014-11-20 19:01:15részletek
1765videoakku.huSysinfo Kft.2014-11-20 19:01:07részletek
1766viessmann-3d.huVIESSMANN Modellgyártó Kft2014-11-20 19:01:11részletek
1767vilagitaskorszerusites.huE.ON Energiakereskedelmi Kft.2014-11-17 14:01:07részletek
1768villamgrill.huJuhász Benjámin2014-11-19 23:01:06részletek
1769villanymargareta.huPászti János2014-11-17 19:01:22részletek
1770vinko.huVinkó Zoltán Tamás2014-11-18 19:01:04részletek
1771violetpiano.huViolet Piano Kft.2014-11-19 23:01:02részletek
1772virtualbank.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
1773virusirtasszolnok.huADACSA Kft.2014-11-18 14:01:12részletek
1774viz-urb.huVarga Imre Zoltán2014-11-19 14:01:20részletek
1775vizfutes.huTóth Ferenc2014-11-19 19:01:19részletek
1776vizmernok.huKristóf Csaba2014-11-19 14:01:10részletek
1777vízmérnök.huKristóf Csaba2014-11-19 14:01:08részletek
1778voicegroup.huCyclick Kft.2014-11-19 23:01:08részletek
1779volkeroliver.huVölker Tamás2014-11-21 14:01:05részletek
1780völker.huVölker Tamás2014-11-18 19:01:02részletek
1781vp-cloud.huGASORG Kft.2014-11-20 14:01:14részletek
1782vpospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1783vrbolt.huSánta Sándor2014-11-18 23:01:21részletek
1784vrjatekok.huSánta Sándor2014-11-18 23:01:22részletek
1785vrshop.huSánta Sándor2014-11-18 23:01:22részletek
1786vrszemuveg.huSánta Sándor2014-11-18 23:01:24részletek
1787vrszemuvegek.huSánta Sándor2014-11-18 23:01:24részletek
1788vteshungariangrandprix.huNémeth Zoltán2014-11-18 23:01:11részletek
1789vtransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1790vv9.huKókai László2014-11-18 14:01:07részletek
1791wallies.huKrix Zoltán2014-11-20 14:01:09részletek
1792watersafe-system.huCsiba Gergely2014-11-19 14:01:19részletek
1793watersafe.huCsiba Gergely2014-11-19 14:01:19részletek
1794wdconsulting.huWD Consulting Kft2014-11-20 14:01:02részletek
1795webajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
1796webdesignart.huVoleszák-Szabó Anita2014-11-19 19:01:20részletek
1797webdesignsolution.huVisnyocki Norbert2014-11-19 19:01:20részletek
1798webedinadesign.huRobin és Társa Bt.2014-11-19 19:01:19részletek
1799webfunz.huNoname Domain Kft.2014-11-20 14:01:08részletek
1800webjogforras.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:30részletek
1801webjogtanacsado.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:18részletek
1802webkepzes.huBalla Ádám2014-11-17 14:01:03részletek
1803weboldalszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
1804webpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:04részletek
1805webrain.huKrix Zoltán2014-11-19 19:01:08részletek
1806weddingonline.huKovács Ádám e.v. 2014-11-17 14:01:14részletek
1807weldminker.huWeldminker Kft.2014-11-21 14:01:09részletek
1808wellnesspatextil.huDagdelen Emrah2014-11-18 19:01:03részletek
1809welovelashes.huMáté Ágnes2014-11-19 14:01:04részletek
1810whiteingatlan.huSmicskó Ágnes e. v.2014-11-18 23:01:04részletek
1811windowsvilag.huMolnar Sándor2014-11-21 14:01:14részletek
1812wineboutiqe.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
1813wineboutique.huBusiness Innovant Kft. 2014-11-21 19:01:05részletek
1814winedesign.huNotrix-Magyarország Kft2014-11-19 14:01:12részletek
1815wizardkartya.huSuba Gergely2014-11-16 19:01:05részletek
1816wmaps.huKrix Zoltán2014-11-19 19:01:15részletek
1817wokzilla.huPADOS PIPI Kereskedelmi Betéti Társaság2014-11-21 19:01:19részletek
1818wonder-cool.huBrill Life Média Kft.2014-11-16 19:01:04részletek
1819woodman.huErdélyi-Woodman Kft.2014-11-18 23:01:03részletek
1820wooo.huVIDGET.HU Kft.2014-11-18 19:01:06részletek
1821wwair.huEuroDNS S.A.2014-11-19 14:01:21részletek
1822xconnections.huHPS Experience Kft.2014-11-19 23:01:09részletek
1823xes.huMolnár Enikő2014-11-18 14:01:02részletek
1824xmix.huEucalyptus Kft.2014-11-19 23:01:06részletek
1825xplaykonzol.huMolnár Judit Egyéni vállalkozó2014-11-20 14:01:02részletek
1826xrosecrystal.huDáné Alexandra2014-11-17 14:01:19részletek
1827xtree.huProfilm DTP Kft.2014-11-18 14:01:13részletek
1828xxl-tuning.huKrix Zoltán2014-11-19 19:01:08részletek
1829yaleszefek.huDimat Fűtéstechnika Kft2014-11-18 23:01:18részletek
1830yanghong.huYang Hong Kft.2014-11-21 14:01:25részletek
1831yangli.huYangli Kft.2014-11-21 14:01:25részletek
1832yemail.huWinkler Balázs2014-11-21 23:01:02részletek
1833youngbeauty.huYoung Beauty Bt.2014-11-20 19:01:18részletek
1834yourbenefits.huMustafa Györgyi Gina2014-11-18 19:01:03részletek
1835yoursclub.huCséfai Nóra2014-11-20 14:01:15részletek
1836yuhu.huNoname Domain Kft.2014-11-18 23:01:22részletek
1837yuhuu.huHajnády Bence2014-11-20 19:01:10részletek
1838yupri.huPreisvergleich.de Berlin AG2014-11-18 14:01:18részletek
1839zavas.huZAVAS, poslovne resitve, d.o.o.2014-11-21 19:01:19részletek
1840zegmechatronika.huPannon Fejlesztési Alapítvány2014-11-17 19:01:03részletek
1841zeisslataskozpont.huKAISER OPTIKA Szemüvegszalon Kereskedelmi Korlátolt Felelősségű Társaság2014-11-21 23:01:01részletek
1842zeissvisioncenter.huKAISER OPTIKA Szemüvegszalon Kereskedelmi Korlátolt Felelősségű Társaság2014-11-21 23:01:02részletek
1843zemplenkincsei.huZemplén Kincsei Szociális Szövetkezet2014-11-17 14:01:24részletek
1844zenmate.huZenGuard GmbH2014-11-18 19:01:02részletek
1845zoldautomento.huMolnár Dávid2014-11-21 14:01:12részletek
1846zoldero.huRuffnet Zrt.2014-11-17 19:01:18részletek
1847zoldhazak.huSilicium Network Kft. (Registrar)2014-11-19 19:01:06részletek
1848zoldkalocsa.huKeiok Kft.2014-11-19 14:01:15részletek
1849zoldso.huB és K Trade Kft.2014-11-20 19:01:20részletek
1850zoutube.huWebsupport s.r.o.2014-11-19 19:01:22részletek
1851zsebmania.huEVADO Kft.2014-11-15 14:01:02részletek
1852zselicsaba.huZseli Csaba2014-11-20 14:01:12részletek
1853zselicvendeghaz.huField & Forest Kft.2014-11-19 19:01:19részletek
1854zsemlemorzsa.huMéry Zoltán2014-11-21 14:01:23részletek
1855zsoltrozsnyai.huRozsnyai Zsolt2014-11-19 19:01:14részletek
1856zsuroteam.huIT DEPO Kft.2014-11-19 23:01:05részletek
1857zyq108.huPongrácz Tibor2014-11-21 19:01:02részletek
Főlap | Regisztrátorok listája | Delegálási szabályok | Meghirdetés | Keresés | Technikai ellenőrzés
Tanácsadó testület | Alternatív vitarendezés | Eseti Választottbíróság | Archívum | Egyebek | Statisztika