Meghirdetés - ABC szerint sorbarendezett lista

Utolsó módosítás: 2014-11-24 16:35:01

SorszámDomain neveIgénylőBejegyzett feltételes használat kezdeteRészletek
10-24-nyomda.huPrádel Zsolt2014-11-21 19:01:04részletek
20-crypt.huINTEGRITY Kft.2014-11-21 14:01:27részletek
3001.huDr.Bedros J. Róbert2014-11-24 14:01:04részletek
40crypt.huINTEGRITY Kft.2014-11-21 14:01:24részletek
510en.huEuroCable Magyarorszag Kft.2014-11-19 14:01:07részletek
611web.huDanyi László2014-11-19 19:01:20részletek
71861pecs.huUpsolution Kft.2014-11-17 14:01:15részletek
81domain.huBártfai Balázs2014-11-18 14:01:05részletek
9212.huMarketingHelp Kft.2014-11-21 14:01:08részletek
10212km.huMarketingHelp Kft.2014-11-21 14:01:08részletek
112box.huMindOn Solutions Kft.2014-11-19 14:01:04részletek
122juhasz.huJuhász Tamás2014-11-17 19:01:13részletek
132zsiraf.huKrix Zoltán2014-11-19 19:01:07részletek
14321car.huHofer Sándor2014-11-19 14:01:14részletek
15365suti.huWe are design Kft.2014-11-20 19:01:19részletek
163d-fal.huGila Ádám2014-11-17 14:01:15részletek
173mango.huTóth Attila2014-11-17 14:01:13részletek
184kstudio.huMedgyesi Zoltán2014-11-22 23:01:02részletek
195starpizza.huMoles Béla E.V.2014-11-21 19:01:12részletek
20619media.huLückl Roland2014-11-18 19:01:07részletek
2167p.huPohl Veronika2014-11-17 19:01:20részletek
22a-part-man.huDél-Alföldi Turisztikai és Idegenforgalmi Szociális Szövetkezet2014-11-20 19:01:07részletek
23a-szalon.huUdvardi Péter2014-11-20 19:01:08részletek
24a01.huKrix Zoltán2014-11-19 19:01:12részletek
25aaaa.huGéczi János2014-11-18 14:01:08részletek
26abasarioltvany.huAbasár Község Önkormányzata2014-11-19 19:01:20részletek
27abasariterko.huAbasári Nonprofit Településüzemeltetési és Fejlesztési Kft. 2014-11-19 19:01:20részletek
28abde.huAlföld-Budapest-Dunántúl Felnőttképzési és Humánszolgáltató Egyesülés2014-11-19 23:01:10részletek
29acci.huZ-Terv Stúdió Kft.2014-11-18 23:01:18részletek
30accountspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
31aceremoniakmestere.huKiss Dániel2014-11-19 19:01:21részletek
32aceremoniakmesterei.huKiss Dániel2014-11-19 19:01:11részletek
33acrysoftrestor.huMarkMonitor International Ltd.2014-11-17 19:01:04részletek
34adamklinika.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:15részletek
35adamsegedeszkoz.huBCMI - Plussz Egészségklinika Kft.2014-11-18 23:01:23részletek
36adotanacsadoszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
37adplanee.huSenpai Consulting Kft. 2014-11-21 14:01:23részletek
38adress.huInter-Abacus Kft.2014-11-24 14:01:23részletek
39adsolute.huWebsupport s.r.o.2014-11-20 14:01:12részletek
40adventbécs.huTóth Éva2014-11-17 14:01:23részletek
41aeek.huUniweb Plusz Kft2014-11-20 19:01:06részletek
42aerosus.huEuro-Trans Hungary Kft.2014-11-16 19:01:05részletek
43agileeconomy.huXerox Magyarország Kft.2014-11-21 14:01:25részletek
44agoratermeloipiac.huAgora a Termelők Piacáért Egyesület2014-11-18 23:01:04részletek
45agostonalapitvany.huÁgoston Sándor Alapítvány2014-11-18 14:01:04részletek
46agyhatalom.huTúri Lajos2014-11-17 19:01:02részletek
47agyhuzat.huSteiner Hajnal2014-11-21 14:01:29részletek
48agymozi.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
49airacademy.huWebenlét Kft.2014-11-18 19:01:04részletek
50ajandekba.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
51ajandeknyomda.huGurmai Sándor 2014-11-17 19:01:22részletek
52ajandekoznijo.huPárta Péter2014-11-17 14:01:03részletek
53ajkarockband.huKrix Zoltán2014-11-20 14:01:12részletek
54ajto-kilincs.huB&M Mechanika Kft.2014-11-17 19:01:04részletek
55ajtoablakaruhaz.huMOBILPARTNER HUNGARY Kft.2014-11-21 19:01:10részletek
56akciohazhozmegy.huD-Com Group Kft.2014-11-21 14:01:09részletek
57akciok-blackfriday.huMINDEKA IT SRL2014-11-21 19:01:14részletek
58akciok-kedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:06részletek
59akciokkedvezmenyek.huProfit Solutions Kft.2014-11-18 23:01:05részletek
60akkuhazhoz.huFöldesi Zsolt2014-11-16 19:01:07részletek
61akkuport.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
62akkuzona.huDÉLAKKU Kft.2014-11-19 14:01:06részletek
63aktivsportok.huSWA Szervíz Kft2014-11-17 19:01:14részletek
64alacream.huWestsidecafe Creative Kft.2014-11-21 19:01:03részletek
65aladdingsm.huTÁM-FAL 2000. Kereskedelmi, Ipari és Szolgáltató Bt.2014-11-21 14:01:15részletek
66alakformaloharisnya.huÖko-PC Kft.2014-11-21 19:01:16részletek
67alefgaszt.huAlefgaszt Kft.2014-11-17 19:01:13részletek
68alizium.huNagy-Kollár Alíz2014-11-17 19:01:09részletek
69alkalmi-buvohelybuda.huPécsvári Richárd2014-11-18 14:01:13részletek
70alkus.huMeva Zsalurendszerek Zrt.2014-11-20 14:01:13részletek
71allatbutor.huVágner Adrienn2014-11-18 14:01:09részletek
72allattartovagyok.hu4SZS Kft.2014-11-18 23:01:14részletek
73alloasztal.huNowart Bt.2014-11-21 19:01:02részletek
74almamania.huKrix Zoltán2014-11-19 19:01:14részletek
75almaregio.huEast-Gate Bt2014-11-21 23:01:02részletek
76almerabonto.huDemmel László2014-11-19 23:01:06részletek
77almresort-gerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:14részletek
78almresortgerlitzen.huCartour Idegenforgalmi Szolgáltató Kft.2014-11-20 19:01:12részletek
79alomgardrob.huKoch-Babics Éva2014-11-18 23:01:10részletek
80alsoorsiplebania.huAlsóörs Római Katolikus Plébánia2014-11-20 14:01:09részletek
81altershop.huVincze Dávid2014-11-19 19:01:17részletek
82alufeny.huB&M Mechanika Kft.2014-11-17 19:01:05részletek
83amarodrom.huIntronet Szoftverfejlesztő és Informatikai Kft.2014-11-21 19:01:07részletek
84amatorsulyemeles.huWalcz Krisztián2014-11-21 14:01:19részletek
85amatőr-szex.huDiczkó Csaba2014-11-20 19:01:06részletek
86ambulanciaspolo.huAmbulance Medical Kft.2014-11-18 23:01:13részletek
87ambupolo.huAmbulance Medical Kft.2014-11-18 23:01:11részletek
88ameddosegellen.huSzmola Erika2014-11-19 14:01:13részletek
89amedical.huAmbulance Medical Kft.2014-11-18 23:01:10részletek
90amegoldas.konyvelo.huA MEGOLDÁS Könyvelő Kft.2014-11-17 14:01:24részletek
91amitarsashazunk.huLivingstones Hungary Kft.2014-11-17 23:01:02részletek
92anapitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
93anál.huDiczkó Csaba2014-11-21 14:01:22részletek
94andrassypinceszet.huEuro Pcdoctor Kft.2014-11-24 14:01:12részletek
95androidpenztargep.huNazza Software Kft.2014-11-20 14:01:13részletek
96angyaliajandek.huTóthné Szabó Andrea2014-11-21 19:01:20részletek
97angyalkertkisvarda.huSzent György Görögkatolikus Óvoda és Általános Iskola 2014-11-21 14:01:18részletek
98anikodxn.huFaragó Anikó2014-11-17 19:01:09részletek
99animaljam.co.huWebenlét Kft.2014-11-16 19:01:04részletek
100animaljam.huWebenlét Kft.2014-11-16 19:01:04részletek
101annadesign.huPataki Annamária2014-11-18 23:01:20részletek
102anne-webshop.huMódium Divatház Kft.2014-11-21 19:01:13részletek
103anovenydoki.huUjvári Péter2014-11-20 19:01:21részletek
104ansell.huNagy és Fiai Kft2014-11-24 14:01:25részletek
105antiokostelefon.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
106antismartphone.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
107anyagtudomanykft.huAnyagtudomány Kutató, Fejlesztő és Szolgáltató Kft.2014-11-21 19:01:15részletek
108anyalelek.huDénes Margit2014-11-18 14:01:03részletek
109anyosijuditoldala.huÁnyosi Judit2014-11-24 14:01:21részletek
110anzix-art.huDeák-Fogarasi István2014-11-19 14:01:04részletek
111apartmango.huIstvándi János2014-11-19 14:01:05részletek
112apay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
113api-solutions.huIMARKET Kft.2014-11-24 14:01:25részletek
114aqua-ponia.huCsiba Gergely2014-11-19 14:01:20részletek
115aquaponic-system.huCsiba Gergely2014-11-19 14:01:20részletek
116aquaponic.huCsiba Gergely2014-11-19 14:01:02részletek
117aquaponics-system.huCsiba Gergely2014-11-19 14:01:19részletek
118aquastic.huWebsupport s.r.o.2014-11-18 14:01:29részletek
119aranea.huSüleweb Kft.2014-11-21 14:01:10részletek
120araneae.huSüleweb Kft.2014-11-24 14:01:08részletek
121araneaengine.huSüleweb Kft.2014-11-21 14:01:10részletek
122araneum.huSüleweb Kft.2014-11-24 14:01:04részletek
123aranyeda.huKoncz Edit2014-11-20 19:01:09részletek
124aranyer-ambulancia.huMDC Medical Group Kft.2014-11-21 14:01:11részletek
125aranyerambulancia.huMDC Medical Group Kft.2014-11-21 14:01:06részletek
126aranypart.huCetinje s.r.o.2014-11-19 19:01:01részletek
127arcreform.huKoós Viktória2014-11-24 14:01:06részletek
128arkenstonemainecoon.huNagy Éva2014-11-18 23:01:03részletek
129arnytechnika.huMimas System Kft2014-11-20 14:01:09részletek
130aroma-one.huAtlantis Systems, s.r.o.2014-11-19 23:01:11részletek
131aromaone.huAtlantis Systems, s.r.o.2014-11-19 23:01:10részletek
132artandcraft.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:25részletek
133artisteer.huKollár-Ker Kft.2014-11-22 23:01:02részletek
134artmta.huSzilágyi Sándor2014-11-21 14:01:05részletek
135aru24.huHencz Imre e.v.2014-11-17 14:01:09részletek
136aspentravel.huKrix Zoltán2014-11-19 19:01:08részletek
137asvanycenter.hu Buri Krisztián E.V.2014-11-24 14:01:03részletek
138aszemelyisoforod.huSzmola Erika2014-11-19 14:01:16részletek
139aszesz2003kft.huÁSZ-ÉSZ 2003 Gazdasági Szolgáltató és Építészeti Kft2014-11-19 14:01:10részletek
140asztalos-keszthely.huBIOFA-GYENES Kft2014-11-18 23:01:17részletek
141asztalosattila.huDr. Asztalos Attila2014-11-17 14:01:21részletek
142asztrologia24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
143at-kft.huEgyütt Egymásért Arthur Troop Nonprofit Kft.2014-11-21 14:01:25részletek
144atac.huATAC Informatikai, Kereskedelmi és Szolgáltató Kft.2014-11-20 19:01:08részletek
145atecuccod.huAkrouf Design Kft2014-11-19 19:01:13részletek
146atrainer.huTóth Alexandra2014-11-17 19:01:05részletek
147atrinova.huDespa Trust Kft.2014-11-18 23:01:12részletek
148atriumfoto.huDudásné Kovács Renáta EV2014-11-21 14:01:19részletek
149attilavill.huATTILAVILL Kft.2014-11-18 14:01:07részletek
150attractivcenter.huEuroDNS S.A.2014-11-17 14:01:04részletek
151auchandirect.huFortax Kft.2014-11-12 14:01:29részletek
152auchandirekt.huFortax Kft.2014-11-12 14:01:16részletek
153autogumi24net.huminden24 Információ Kft2014-11-18 23:01:15részletek
154autojaertkeszpenzazonnal.huA111 Autó Kft.2014-11-18 23:01:15részletek
155autojot.huOzsváth János2014-11-18 23:01:15részletek
156autoplusz.huEuroDNS S.A.2014-11-17 14:01:16részletek
157autoszervizpenztargep.huNazza Software Kft.2014-11-17 19:01:19részletek
158azeskuvo.huNagy Gergely Csaba2014-11-21 14:01:09részletek
159azeskuvonk.huBalajti István2014-11-17 14:01:04részletek
160azsiailanyok.huDiczkó Csaba2014-11-20 14:01:11részletek
161azzurracouture.huLuxuria Moda Kft2014-11-19 23:01:12részletek
162átvételi-pont.huManda Kft.2014-11-18 14:01:01részletek
163b-g.huNémeth Lajos2014-11-18 19:01:06részletek
164b-intense.huB-intense GmbH Als Zweigniederlassung Der CB-Capital GmbH2014-11-17 23:01:01részletek
165bababiznisz.huZaláné Csörsz Eszter2014-11-21 14:01:06részletek
166babauszas.co.huLonkai Adrienn2014-11-20 19:01:06részletek
167babeldelicate.huKrix Zoltán2014-11-19 19:01:14részletek
168babydesign.huDevron-Impex Kft2014-11-19 14:01:18részletek
169bachatasuli.huSzádvári Zoltán2014-11-24 14:01:15részletek
170bachcseppek.huÉden-Esszencia Kft2014-11-18 23:01:23részletek
171bacsa-konyvelokft.huBacsa-Könyvelő Kft.2014-11-18 23:01:11részletek
172bacska-online.huKecskés Zsolt2014-11-17 19:01:07részletek
173bakeshop.huKurai Péter2014-11-21 14:01:17részletek
174balaton-tv.huVeresegyházi Városi Televízió Kft.2014-11-17 19:01:05részletek
175balatonfeinkost.huBalatonFeinkost Kft.2014-11-21 14:01:11részletek
176balatontickets.huTktStaff Kft.2014-11-17 14:01:11részletek
177balazska.huFöldházi Balázs2014-11-19 14:01:06részletek
178bandart.huGalaktika Szakkör Bt.2014-11-21 14:01:10részletek
179barbara.co.huMark Marketing Kft.2014-11-17 14:01:16részletek
180barbikuckoja.huBoda Barbara2014-11-21 19:01:04részletek
181baromfitragya.huTóth Attila2014-11-19 14:01:06részletek
182bartime.huNehmar Yacine2014-11-18 14:01:24részletek
183batyifc.huGombás Péter2014-11-20 14:01:15részletek
184baxalta.co.huBaxter Healthcare Corporation2014-11-19 23:01:02részletek
185baxalta.huCorporation Service Company (UK) Limited 2014-11-19 14:01:12részletek
186bbbau.huKovács Attila2014-11-18 14:01:11részletek
187bbpragmatic.huBagyánszky Zoltán Márió2014-11-20 19:01:12részletek
188bbq-shop.huSchäffer Ádám Dávid2014-11-24 14:01:23részletek
189bcfxbroker.huRozgonyi György2014-11-20 19:01:21részletek
190beanlight.hu Discovery Bliss Kft.2014-11-17 19:01:20részletek
191beautylinestyle.huDigitaltrends Magyarország Kft.2014-11-24 14:01:09részletek
192beautypoint.huKeresztesi Ildikó2014-11-21 19:01:19részletek
193bedcinema.huNarancssárga Angyal Műszaki Segélyszolgálat kft.2014-11-17 14:01:20részletek
194beeboo.huTanyik Adrienn2014-11-19 19:01:15részletek
195behopp.huTokai Sándor e.v.2014-11-21 14:01:05részletek
196bekesijarasok.huMCOnet International Kft.2014-11-18 14:01:04részletek
197belkinsupport.huFarago Sandor2014-11-17 14:01:08részletek
198bellozzo.huFusion Befektetési Zrt.2014-11-20 19:01:01részletek
199belsoepiteszstudio.huIDM Group Kft. 2014-11-17 19:01:01részletek
200beltekcoop.huBéltek Coop Zrt.2014-11-18 14:01:17részletek
201bempark.huGreen Residence Kft.2014-11-24 14:01:13részletek
202bencecoach.huNoname Domain Kft.2014-11-16 19:01:03részletek
203berczy.huBérczy Gergely2014-11-17 14:01:04részletek
204bernover.huAmbulance Medical Kft.2014-11-18 23:01:14részletek
205bestclean.huHussein Zoltán2014-11-18 14:01:03részletek
206bestdivingplaces.huKrix Zoltánné2014-11-18 14:01:10részletek
207bestgoulash.huAgrocorp Consulting Kft2014-11-21 14:01:01részletek
208beugrok.huSZIGETKÖZ.NET Kft.2014-11-19 19:01:10részletek
209beutumszalon.huRobitz Anikó2014-11-24 14:01:14részletek
210bécs.huTóth Éva2014-11-18 19:01:07részletek
211bfb.co.huB.F.B. CONSULTING Kft.2014-11-17 19:01:15részletek
212bfn.huBloom Fashion Group Kft.2014-11-18 14:01:30részletek
213bigbuy.huBichis János2014-11-18 19:01:01részletek
214bigdog.huPintyéné Deák Anita2014-11-19 19:01:03részletek
215billpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
216bio-sor.huWebsupport s.r.o.2014-11-24 14:01:28részletek
217biofa-gyenes.huBIOFA-GYENES Kft2014-11-18 23:01:14részletek
218bionikusalapitvany.huSzűcs László2014-11-17 14:01:02részletek
219biorezo.huLadányi Zsuzsanna2014-11-20 14:01:07részletek
220biotea.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
221bistromandarin.huGBaRT Design Stúdió Kft.2014-11-18 14:01:11részletek
222bitsector.huWebon Consulting Kft.2014-11-18 14:01:11részletek
223biztonsagmuhely.huBiztonság Műhely Szolgáltató Szociális Szövetkezet2014-11-17 19:01:06részletek
224biztositas24net.huminden24 Információ Kft2014-11-18 23:01:23részletek
225blackcode.huVerhás Dániel2014-11-19 19:01:16részletek
226blackdiamondportfolio.huGold Trader & Co. Befektetési Ügynökség Kft.2014-11-19 14:01:03részletek
227blackfridays.huNoname Domain Kft.2014-11-20 14:01:12részletek
228blankart.huSimon Levente2014-11-18 14:01:12részletek
229blog-probiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
230blogprobiotikum.huVitaminKosár Kft.2014-11-20 19:01:20részletek
231bminfo.hueCapital.hu Kft.2014-11-20 19:01:17részletek
232bocskaigimnazium.hu Bocskai István Alapitvány2014-11-17 14:01:10részletek
233bodzsi.huHorváthné Bodzsár Szilvia 2014-11-20 19:01:15részletek
234bolho.huBolhó Község Önkormányzata2014-11-18 23:01:08részletek
235bontottarbanujalkatresz.huSH Group Kft.2014-11-19 19:01:17részletek
236bonuszlap.huKontroll Média Kft2014-11-24 14:01:18részletek
237bonuszoldal.huKontroll Média Kft2014-11-24 14:01:08részletek
238bonzo.huEuroCable Magyarorszag Kft.2014-11-17 14:01:24részletek
239booklin.huIntec Online Kft. (Registrar)2014-11-24 14:01:15részletek
240borealattispenzvan.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
241boritekolas.huBártfai Balázs2014-11-20 14:01:05részletek
242borsabrown.huPublish and More Kft.2014-11-18 19:01:03részletek
243borsokaland.huGulyás júlia2014-11-18 14:01:28részletek
244borthordok.huPulispace Fejlesztő és Szolgáltató Kft.2014-11-21 19:01:11részletek
245borwebaruhaz.huNet-Tech Consulting Kft.2014-11-17 14:01:01részletek
246boxbufe.huAFIS Kft.2014-11-20 14:01:01részletek
247bptech.huMilassin András2014-11-20 14:01:15részletek
248braintrainer.huHorváth Eszter2014-11-24 14:01:13részletek
249brandandtrend.hu CIPŐGURU KFT.2014-11-17 23:01:01részletek
250brandfriends.huTóth Balázs2014-11-18 23:01:08részletek
251brankoholding.huBranko Holding Zrt.2014-11-21 19:01:06részletek
252brickleberry.huNoname Domain Kft.2014-11-16 19:01:06részletek
253brikettgyar.huBrikettpont Kft.2014-11-19 19:01:16részletek
254bringacentrum.huKercom Kft2014-11-18 19:01:07részletek
255bsbnetwork.huBalogh Sándor2014-11-17 14:01:06részletek
256bububababolt.hu Kígyós Ferenc2014-11-17 14:01:23részletek
257budaiborbely.huBARBER ART KFT2014-11-21 19:01:04részletek
258budaiborszalon.huKrix Zoltán2014-11-19 19:01:08részletek
259budakeszikonyvelo.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:05részletek
260budakeszikonyveloiroda.huPetra Property Ingatlahasznosító és Szolgáltató Kft.2014-11-20 14:01:09részletek
261budapestartweekend.huBérczi Linda2014-11-19 14:01:11részletek
262budapestfashionnight.huBloom Fashion Group Kft.2014-11-18 14:01:10részletek
263budapestgoulash.huAgrocorp Consulting Kft2014-11-21 14:01:07részletek
264budapesthelicopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
265budapesthelikopter.huFortis Solutio Kft.2014-11-18 14:01:26részletek
266budapestickets.huTktStaff Kft.2014-11-17 14:01:12részletek
267budapestiugyvediiroda.huDr. Fórizs Zsolt 2014-11-20 19:01:02részletek
268budapestkutyakozmetika.huWinkler Judit2014-11-18 14:01:05részletek
269budapestriksa.huSzőke Tibor2014-11-21 19:01:05részletek
270budapestwiengid.huHorváth Dóra2014-11-17 14:01:18részletek
271budavara.huTredit-SOL Kft.2014-11-18 23:01:07részletek
272bujinkanbudapest.huEuroDNS S.A.2014-11-17 14:01:16részletek
273burgpalast.huTredit-SOL Kft.2014-11-18 23:01:05részletek
274butorasztalosszeged.huHorváth Ferenc2014-11-24 14:01:22részletek
275butorbolt-cegled.huRutai Sándor2014-11-20 19:01:07részletek
276butorkapu.huKorcsok Sándor2014-11-21 19:01:06részletek
277butorszerelok.huKrix Zoltán2014-11-19 19:01:11részletek
278buvohelybuda.info.huPécsvári Richárd2014-11-18 14:01:22részletek
279buvohelybudaors.huPécsvári Richárd2014-11-18 14:01:13részletek
280buyandsale.huGEO-13 KFT.2014-11-21 14:01:22részletek
281bvda.huTredit-SOL Kft.2014-11-18 23:01:06részletek
282calibrapet.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:21részletek
283calibratap.huINTERPET Kereskedelmi és Szolgáltató KFT2014-11-17 19:01:19részletek
284cammogo.huCreateam Reklámügynökség Kft2014-11-20 19:01:02részletek
285cardless.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
286cardlesspay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
287carlock.huCyclick Kft.2014-11-19 23:01:02részletek
288casiokarora.huKöles Antal2014-11-21 19:01:10részletek
289casioora.huKöles Antal2014-11-21 19:01:19részletek
290cedrusudvar.huCodemakers Kft2014-11-19 23:01:07részletek
291cegledpartner.huKonrext Kft.2014-11-19 19:01:01részletek
292cegnevsor.huBártfai Balázs2014-11-20 19:01:05részletek
293cekka.huHorváthné Kiss Claudia EV2014-11-18 14:01:09részletek
294celeris.huUnidomain Kft.2014-11-19 19:01:06részletek
295centrumrentacar.huBajcsi Illés Antalné2014-11-21 14:01:15részletek
296ceremoniakmestere.huKiss Dániel2014-11-19 14:01:16részletek
297ceremoniakmesterei.huKiss Dániel2014-11-19 14:01:17részletek
298chatvonal.huConPhone Audio Conferening Kft.2014-11-18 14:01:10részletek
299chetrin.huCHETRIN Szociális Szövetkezet2014-11-18 14:01:15részletek
300chezdodo.huMacaron és társai Kft.2014-11-17 14:01:09részletek
301chilitec.huArtSoft Hungary Kft.2014-11-17 14:01:11részletek
302chipolino.huDevron-Impex Kft2014-11-19 14:01:18részletek
303chop.huKovács Balázs2014-11-17 14:01:13részletek
304cicasitter.huHavasvölgyi Csilla2014-11-21 19:01:19részletek
305cilter.huCyclick Kft.2014-11-19 23:01:02részletek
306cityeuro.huKántor László2014-11-21 14:01:07részletek
307cityflatoperator.huVárhelyi Bence2014-11-21 19:01:08részletek
308citygardens.huE-Building kft 2014-11-19 14:01:06részletek
309classhostess.huFülöpp Péter2014-11-18 14:01:29részletek
310classmodell.huFülöpp Péter2014-11-18 14:01:30részletek
311clearplanet.huClear Planet Zrt.2014-11-19 14:01:08részletek
312clevee.huYegon s.r.o.2014-11-24 14:01:20részletek
313cleverframe.huLeme Kft2014-11-19 14:01:17részletek
314clickbox.huSwift Technologies Kft.2014-11-20 19:01:22részletek
315clickcenter.huCzézár Csanád2014-11-21 14:01:23részletek
316clickport.huMalindovszky Tamás2014-11-21 19:01:04részletek
317clublondon.huT.A.E.V. Kft.2014-11-21 14:01:04részletek
318cocktailforever.huBencsik Szilveszter2014-11-19 23:01:08részletek
319coinpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
320colorpor.huEuroDNS S.A.2014-11-17 14:01:16részletek
321computerpanorama.huKrix Zoltán2014-11-19 19:01:11részletek
322concria.huBelotti Kft2014-11-24 14:01:18részletek
323conphone.huConPhone Audio Conferening Kft.2014-11-19 19:01:05részletek
324conteharisnya.huÖko-PC Kft.2014-11-21 19:01:14részletek
325controlsys.huCONTROSYS Irányítástechnikai Kft.2014-11-21 14:01:19részletek
326coolmovie.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
327cowbells.huMagyar Csanád2014-11-24 14:01:13részletek
328cpptrade.hu Leidgeb Dániel2014-11-17 14:01:05részletek
329creativejob.co.huFarkasfalvi Balázs2014-11-19 14:01:08részletek
330creatiw.huLuremta Ker. Kft.2014-11-18 14:01:29részletek
331creditpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
332crystalszepsegszalon.hu6 sz. 2010. Kft.2014-11-18 23:01:01részletek
333csabapolo.huCsabai Csirkefogók Vizilabda Klub2014-11-17 14:01:13részletek
334csakajokmennekel.huClassik Marketing Kft.2014-11-20 19:01:10részletek
335csakany-es-penna-kovycs59.huKovács László2014-11-18 14:01:27részletek
336csakazene.huVarga Sándor E. V.2014-11-18 19:01:06részletek
337csaladikonfliktusok.huAranyos Zsolt2014-11-20 19:01:21részletek
338csaladikonyha.hu"Családi Tűz" Kft2014-11-24 14:01:16részletek
339csaladjogpecs.huDr. Valler Zsuzsa2014-11-21 14:01:16részletek
340csatlakoznek.huLak Antal2014-11-21 19:01:14részletek
341csavarplusz.huHajas Gábor Péter2014-11-19 14:01:08részletek
342csavartrade.huVass István2014-11-19 14:01:18részletek
343csempe-furdoszoba.huVarga Tamás2014-11-17 14:01:21részletek
344csendtest.huMarkovich Zsigmond2014-11-21 14:01:30részletek
345cseporke.huVarga Tamás2014-11-21 19:01:07részletek
346cserkoakku.huCserné Radonics Piroska2014-11-19 19:01:03részletek
347csigakrem.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
348csigakrém.huPresto-Pilot Kft.2014-11-20 14:01:10részletek
349csikosfuzet.huKarpf Sándor2014-11-21 23:01:03részletek
350csikotuzhely.huPorgesz Gábor2014-11-18 14:01:15részletek
351csillagda.huKrix Zoltánné2014-11-17 14:01:02részletek
352csillagokhaboruja.huSimon Zoltán2014-11-18 14:01:30részletek
353csipetnyidesign.huVisztricz Petra2014-11-19 19:01:15részletek
354csipteto.huGravitas B.V.Á. Kft.2014-11-21 23:01:02részletek
355csizmadiakftpapa.huCsizmadia és Társai Kft.2014-11-20 14:01:09részletek
356csmix.huEcsedi Ádám2014-11-17 19:01:10részletek
357csokifalat.huBor Panna2014-11-18 14:01:28részletek
358csudarumli.huBencsik Szilveszter2014-11-19 14:01:11részletek
359csupaszmacska.huNagy-Ördög Csilla2014-11-19 23:01:11részletek
360cszsgt.huBársony László2014-11-17 19:01:03részletek
361cuponation.huPiquerez Nicolas2014-11-17 19:01:09részletek
362cybertek.huKeeNet Kft.2014-11-21 14:01:02részletek
363dalakedvesnek.huALTAweb Kft.2014-11-20 19:01:20részletek
364dancehallsuli.huSzádvári Zoltán2014-11-24 14:01:17részletek
365dantian.huFortis Solutio Kft.2014-11-18 14:01:25részletek
366danubelkwstore.huZsámbok János2014-11-20 19:01:08részletek
367danubewedding.huVarga-Kovács Tímea2014-11-20 19:01:19részletek
368darlingdekor.huKökényesi Ferenc Dániel2014-11-20 19:01:14részletek
369darumegrendeles.huMegakrán Kft2014-11-24 14:01:09részletek
370daruzasmegrendeles.huMegakrán Kft2014-11-24 14:01:10részletek
371darwin-tol-istenig.huAnonymouse Domains s.r.o.2014-11-19 19:01:22részletek
372datacontrol.huUnidomain Kft.2014-11-19 19:01:04részletek
373db-system.huWebenlét Kft.2014-11-16 19:01:04részletek
374dbmj.huDr. Bűdi Máté János2014-11-24 14:01:18részletek
375dcfxbroker.huRozgonyi György2014-11-20 19:01:09részletek
376de24.huBencsik Szilveszter2014-11-19 14:01:14részletek
377deathfellows.huKrix Zoltán2014-11-19 19:01:08részletek
378deb-habszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:14részletek
379deb-szappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
380debhabszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:12részletek
381debrecentv.huRaycom-GTE Kft2014-11-14 19:01:01részletek
382debszappan.huPolauerné Simon Tímea Julianna2014-11-18 23:01:09részletek
383decofriendly.huSajgó Anikó Józsa2014-11-21 23:01:02részletek
384defibrillatorplus.huVarga Erika2014-11-17 19:01:03részletek
385defibrillatorplusz.huVarga Erika2014-11-17 19:01:04részletek
386dekanter.huKenyeres Mónika2014-11-19 23:01:12részletek
387delelopince.huBusiness Innovant Kft.2014-11-18 14:01:22részletek
388delelőpince.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
389delfinkonyvek.huMaxim Könyvkiadó Kft.2014-11-20 19:01:03részletek
390delkim.huHalász László2014-11-17 19:01:12részletek
391deltaregister.huSántha György2014-11-24 14:01:15részletek
392demeterkis.huDemeter Róbert2014-11-16 19:01:03részletek
393demir.huBakóczy Zoltán2014-11-17 14:01:08részletek
394demokratikusminimum.huHraskó Gábor Tamás2014-11-19 14:01:13részletek
395dentocal.huDr. Antolik Marianna2014-11-21 19:01:20részletek
396dentsanaheviz.huVass Gyula Istvan2014-11-16 19:01:06részletek
397depostone.huFarkas Gyula2014-11-18 14:01:21részletek
398design4-u.huMészáros Dóra2014-11-18 14:01:11részletek
399designdistrict.huKrix Zoltán2014-11-19 19:01:13részletek
400designmadeinhungary.huSimon Péter2014-11-17 19:01:19részletek
401devizatanfolyam.huSolidusfx Trading Kft.2014-11-19 14:01:13részletek
402devsociety.huProject029 Media and Communications Kft.2014-11-18 23:01:24részletek
403diamond-lift.huSipos László2014-11-19 14:01:21részletek
404diamondcosmetics.huNail Shop Bt.2014-11-21 19:01:21részletek
405dietrend.huYes-Média Kft.2014-11-17 19:01:17részletek
406digital-mc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
407digitalis-emlekmentes.huVarga János2014-11-18 23:01:07részletek
408digitalis-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-19 19:01:02részletek
409digitalmc.huProject029 Media and Communications Kft.2014-11-18 23:01:21részletek
410digitalphoto.huDudásné Kovács Renáta EV2014-11-21 14:01:20részletek
411dignity.huEmberi Méltóság Központ2014-11-19 19:01:06részletek
412disz.huWebsupport s.r.o.2014-11-17 14:01:20részletek
413diszallatkutsera.huKutsera Balázs2014-11-20 19:01:01részletek
414diszkontcsempe.huHorváth András2014-11-19 19:01:17részletek
415dixdox.huDigital Packaging and Promotion Kft.2014-11-18 14:01:07részletek
416dizajnzokni.huHelyikupon KFt2014-11-21 14:01:27részletek
417djmakszim.huMakszim Botond 2014-11-21 19:01:02részletek
418djrici.huCivil-Network.hu Kft,2014-11-19 23:01:11részletek
419djspeed.huKovács Győző2014-11-24 14:01:02részletek
420dkl-org.huDKL Műszaki Organizációs Kft.2014-11-17 19:01:04részletek
421dnscarbon.huVarga Dénes2014-11-18 14:01:12részletek
422do-re-mi.huMíves Kft.2014-11-17 19:01:05részletek
423dobosarnyekolastechnika.huDobos József ev.2014-11-18 23:01:10részletek
424dogfurniture.huVágner Adrienn2014-11-18 14:01:11részletek
425dolgosmama.huKovácsné Fenyõ Erzsébet2014-11-19 23:01:04részletek
426domainaffiliate.huMonitor Média Kft.2014-11-20 14:01:07részletek
427domainajanlatok.huMonitor Média Kft.2014-11-20 14:01:06részletek
428domainstartup.huMonitor Média Kft.2014-11-20 14:01:11részletek
429domainstreet.huMonitor Média Kft.2014-11-20 14:01:06részletek
430domino51.huDominó 5/1 Kft2014-11-21 19:01:15részletek
431dominovendeghaz.huEuroDNS S.A.2014-11-17 14:01:17részletek
432doorandglass.huHorváth Gábor2014-11-17 14:01:11részletek
433doorandglassdesign.huHorváth Gábor 2014-11-17 14:01:13részletek
434dotindot.huFerenczi Gábor2014-11-17 19:01:02részletek
435dovre.huWebsupport s.r.o.2014-11-18 14:01:10részletek
436dozsavarosibaratikor.huDózsavárosi Barátikör2014-11-24 14:01:20részletek
437dpelectro.huVértesi Outlet Kft.2014-11-19 23:01:10részletek
438dragonage.huAngyal Levente2014-11-21 14:01:02részletek
439drdata.huVárkonyi Attila2014-11-17 19:01:22részletek
440dreamday.huKender Anita2014-11-17 19:01:08részletek
441dreamfotostudio.hudr Bereczky Orsolya2014-11-20 14:01:03részletek
442drharsanyi.hudr Harsányi Ádám Marcell2014-11-19 14:01:09részletek
443driveroftheyear.huLeasePlan Hungária Zrt.2014-11-21 19:01:03részletek
444drkissedit.huBánhalmi András2014-11-18 19:01:04részletek
445drkocsismaria.hudr. Kocsis Mária2014-11-21 19:01:05részletek
446droidsecurity.huFarkas István2014-11-20 14:01:06részletek
447dronewebshop.huBóna Dániel2014-11-18 14:01:01részletek
448dronkozpont.huFarkas István2014-11-20 14:01:13részletek
449dronozas.huDeák András2014-11-24 14:01:17részletek
450dronszovetseg.huDeák András2014-11-24 14:01:14részletek
451drtouchscreen.huKrausz Tamás2014-11-17 14:01:08részletek
452drvacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:07részletek
453drvacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:19részletek
454ds-drive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
455dsdrive.huAUTOMOBILES CITROEN2014-11-18 14:01:05részletek
456dugás.huDiczkó Csaba2014-11-20 19:01:10részletek
457dugodijzona.huMedia Organisation Kft2014-11-19 23:01:12részletek
458dugulaselharitas-woma.huSimon Szabolcs e.v.2014-11-24 14:01:11részletek
459dugulaselharitas.2000.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:12részletek
460dugulaselharitas.ingatlan.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
461dugulaselharitas.lakas.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
462dugulaselharitas.org.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:11részletek
463dugulaselharitas.video.huTISZTA VÍZ Környezetvédelmi és Szolgáltató Kft2014-11-17 19:01:15részletek
464duly.huEuromarknet Kft. (Registrar)2014-11-21 14:01:07részletek
465dunamentiborok.huWebsupport s.r.o.2014-11-19 19:01:23részletek
466duphalac.huAbbott Laboratories (Magyarország) Kft.2014-11-19 19:01:22részletek
467duschenkakeramia.huDuschenka Gyöngyi 2014-11-24 14:01:23részletek
468dvparking.huDV Info Informatikai Kft.2014-11-21 23:01:02részletek
469dxnganodermakave.huVécsei Renáta2014-11-21 14:01:19részletek
470dxnmegoldas.huCA Megoldás Kft.2014-11-18 23:01:08részletek
471dynamitebaits.huHalász László2014-11-17 19:01:16részletek
472e-dietetikus.huBallai Márta2014-11-18 14:01:30részletek
473e-inst.huHambuch Henrik2014-11-21 14:01:09részletek
474e-tablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:03részletek
475e-tanusitunk.huAnonymouse Domains s.r.o.2014-11-24 14:01:27részletek
476eaglesolutions.huMajoros Dóra2014-11-21 14:01:30részletek
477eatup.huKubicza Food & Drink Kft.2014-11-21 23:01:04részletek
478ebook-webshop.huWisol Kft.2014-11-21 19:01:14részletek
479eciconf-2012.huKrix Zoltán2014-11-19 19:01:14részletek
480ecoheat.huSzél Zoltán2014-11-17 19:01:14részletek
481ectv.huEuroCable Magyarorszag Kft.2014-11-21 19:01:21részletek
482edclingua.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:19részletek
483edcpro.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:19részletek
484ededesign.huPojtli Gábor E.V.2014-11-17 19:01:12részletek
485edesannacukraszdak.huDIAN CAFFE Kft.2014-11-18 14:01:28részletek
486edigit.huMárkus Attila2014-11-24 14:01:15részletek
487edzoviki.huMolnár-Varhol Viktória2014-11-21 19:01:16részletek
488egain.huGarts hungary kft2014-11-21 19:01:01részletek
489egercity.huKrix Zoltán2014-11-19 19:01:09részletek
490egerhonlapkeszites.huBotos Regina2014-11-19 14:01:11részletek
491egeszsege.huUlicska Tamás2014-11-21 19:01:21részletek
492egeszseges-kulacs.huR&B Medilek spol. s r.o.2014-11-18 14:01:15részletek
493egeszsegestudomany.huEgészség és Tudomány Bt.2014-11-20 14:01:04részletek
494egvkft.huÉGV Kft.2014-11-20 19:01:04részletek
495egyetemipolo.huZoltán Balázs2014-11-21 14:01:30részletek
496egyetempolo.huZoltán Balázs2014-11-21 14:01:27részletek
497egzotikusutazasok.huForró Tamás Attila2014-11-18 19:01:06részletek
498ehko.huEhKo Sign Industries Kft.2014-11-19 14:01:20részletek
499eladominden.huKondász Róbert2014-11-21 14:01:06részletek
500electra-kaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:13részletek
501elektrovillbau.huEVB Építő Kft.2014-11-17 19:01:10részletek
502elelemetterem.huÉl-Elem Étterem Kft.2014-11-17 14:01:22részletek
503eletital.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
504eletpalyaori.huKiss Gergely E.V.2014-11-21 19:01:13részletek
505eletvezetesitanacsadas.huDr. Asztalos Attila2014-11-17 14:01:21részletek
506eletvezetesitanacsado.huDr. Asztalos Attila2014-11-17 14:01:21részletek
507elfogadoszeretet.huJ. KOVÁCS JUDIT2014-11-21 14:01:26részletek
508elitbox.huDrlife.eu Kft2014-11-24 14:01:10részletek
509eliteitsys.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
510elitetetofedes.huElite ITSyS Services Kft.2014-11-17 19:01:09részletek
511elitshop.huOpen Solutions Kft. 2014-11-20 14:01:02részletek
512eljegyzesigyuruk.huVér József2014-11-17 14:01:12részletek
513elmenyiskola.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:20részletek
514elmenysuli.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:18részletek
515elomult.huHortobágyi Ágoston2014-11-19 23:01:08részletek
516elsomagyarmegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
517elsomilliom.huPistyur Veronika2014-11-18 14:01:27részletek
518elvisz-busz.huK. és Z. Bt.2014-11-20 19:01:18részletek
519emmt.huWebenlét Kft.2014-11-20 14:01:05részletek
520en-ef.huNagy Mátyás2014-11-24 14:01:28részletek
521energiafa.huSkareb Szociális Szövetkezet2014-11-24 14:01:15részletek
522energiamasszazsoktarhaza.huPecsők László E.V.2014-11-24 14:01:15részletek
523englishteashop.huÁrendásné Baráth Szabina2014-11-18 14:01:01részletek
524engyk.huNoname Domain Kft.2014-11-21 14:01:18részletek
525enterschool.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
526entersuli.huLauritzen Instore Kft.2014-11-21 14:01:04részletek
527entone.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
528epingvin.huIxor.hu Kft2014-11-24 14:01:26részletek
529epishop.huWildenert s.r.o.2014-11-19 19:01:04részletek
530epitesi-hibak.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
531epitesihibakfolyoirat.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
532epitesihibakmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
533epitesihibakszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:19részletek
534epitesiminoseg.huBertoja-Berend András2014-11-20 19:01:15részletek
535epitesitabla.huWebenlét Kft.2014-11-16 19:01:04részletek
536epitoanyagportal.huKirály Zsolt2014-11-17 19:01:22részletek
537epitoaruhaz.huGerbner Dániel Ádám2014-11-20 14:01:09részletek
538epitobolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
539epitoipariaruhaz.huGerbner Dániel Ádám2014-11-24 14:01:08részletek
540epitowebaruhaz.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
541epng.huIxor.hu Kft2014-11-21 23:01:04részletek
542epsystem.huÉP-SYSTEM XXI KFT.2014-11-21 14:01:20részletek
543erdelyimagyarokkozossege.huWebsupport s.r.o.2014-11-17 19:01:08részletek
544erdino.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
545erdinopont.huM-Network Informatika Kft.2014-11-19 14:01:17részletek
546erdosdenes.huErdős Dénes2014-11-17 19:01:20részletek
547eriknewmanmusic.huExtrico Systems Hungary Zrt.2014-11-20 19:01:21részletek
548erintesfurdo.huKállai Éva Egyéni Vállalkozó2014-11-20 19:01:01részletek
549erstejotett.huWUNDERMAN Marketing Tanacsado Kft2014-11-21 14:01:24részletek
550ertekekhaza.huSzimbiózis a Harmonikus Együtt-létért Alapítvány2014-11-18 23:01:11részletek
551erzeki-korea.huAnonymouse Domains s.r.o.2014-11-24 14:01:27részletek
552erzsebetovi.huEsztergomi Erzsébet Királyné Óvoda2014-11-22 23:01:01részletek
553esernyő-shop.huTóth Péter E.V.2014-11-20 14:01:04részletek
554esikon.huD 180 Kft.2014-11-20 14:01:04részletek
555eskuvo1x1.huÁrvai Tibor2014-11-21 19:01:07részletek
556eskuvotoszkana.huVarga-Kovács Tímea2014-11-21 14:01:28részletek
557espiro.huDevron-Impex Kft2014-11-19 14:01:18részletek
558etablakonyv.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:05részletek
559etteremlatogato.huSzilléri Kft.2014-11-18 14:01:22részletek
560eumail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
561euphoriaorg.huTroll Gergő2014-11-20 14:01:08részletek
562euro.city.huKántor László2014-11-21 19:01:06részletek
563eurocel.huSARATOGA HUNGARY KFT.2014-11-24 14:01:20részletek
564eurokartevoirtas.huDomoszlai Dávid2014-11-17 14:01:15részletek
565euronyelviskola.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:15részletek
566europacantat.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:10részletek
567europacantatpecs.huBolko Reklám és Szolgáltató Bt.2014-11-19 14:01:09részletek
568europe-motion.huEurope Motion Kft.2014-11-18 23:01:09részletek
569europroperty.huUdut Attila2014-11-21 19:01:04részletek
570eva-blog.huBerecz Istvánné2014-11-18 23:01:23részletek
571evendi.hueVendi GmbH & Co. KG2014-11-20 14:01:01részletek
572everydaybudapest.huMudra László2014-11-17 14:01:15részletek
573everydays.huDIST Informatikai Szolgáltató Bt. 2014-11-24 14:01:23részletek
574evezzobudan.huGanz Villamossági Evezős Klub 2014-11-18 14:01:15részletek
575evilangel.huEuroDNS S.A.2014-11-20 14:01:11részletek
576ewordoc.huRoxboro Hungary Kft.2014-11-21 19:01:18részletek
577exertus.huExertus Trade Kft2014-11-20 19:01:08részletek
578expressznethirdetes.huNGKE Kft.2014-11-24 14:01:20részletek
579ezsport.huSWA Szervíz Kft2014-11-17 19:01:01részletek
580ezteszed.huGórász Gréta2014-11-19 14:01:07részletek
581ezustpallos.huBodnár Balázs2014-11-18 23:01:17részletek
582építési-hibák.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
583építésihibák.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
584építésihibákfolyóirat.huFórum Média Kiadó Kft.2014-11-18 14:01:21részletek
585építésihibákmagazin.huFórum Média Kiadó Kft.2014-11-18 14:01:18részletek
586építésihibákszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:17részletek
587f-h.huISD DUNAFERR Zrt.2014-11-17 19:01:17részletek
588f50divataru.huTóth Anita2014-11-18 23:01:20részletek
589fabutorpecs.huPernyéz Viktor2014-11-20 19:01:20részletek
590factory-outlet.huIT Remarketing Kft.2014-11-19 14:01:12részletek
591factoryoutlet.huIT Computer Trading Kft.2014-11-19 14:01:19részletek
592faeka.huHenkel Magyarország Kft2014-11-17 19:01:09részletek
593familiaszabo.huSzabó Zoltánné 2014-11-24 14:01:05részletek
594familiatermekek.huPick Szeged Zrt.2014-11-18 14:01:24részletek
595famousmusic.huNép Anita2014-11-21 23:01:04részletek
596fantasticstores.huSzombati Gergő László2014-11-21 14:01:16részletek
597fapadoshosting.huFarago Sandor2014-11-21 14:01:27részletek
598fapadoshoszting.huFarago Sandor2014-11-21 14:01:23részletek
599farkasfitness.huFarkas Gyula2014-11-20 14:01:14részletek
600farmrtk.huFöldmérési és Távérzékelési Intézet2014-11-18 14:01:05részletek
601fashionizer.huSCHWABEN CONSULTING Bt.2014-11-19 14:01:11részletek
602fatness2fitness.huSzűcs Eszter2014-11-21 23:01:03részletek
603fdmtrade.huFDM TRADE Kft.2014-11-17 14:01:13részletek
604fehervarparodontologus.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:11részletek
605feichtart.huPetz Rita2014-11-24 14:01:16részletek
606fejlesztot-keresek.huMolnár István2014-11-19 23:01:07részletek
607feketehegyingatlan.huSzáler Gábor2014-11-17 14:01:14részletek
608feketepéntek.huZebrateam Kft2014-11-21 23:01:02részletek
609feketezzunk.huEgyütt az Iskoláért Alapítvány2014-11-18 23:01:21részletek
610felarak.huWebsupport s.r.o.2014-11-19 23:01:07részletek
611felemelkedes.huPetrásovits Zoltán2014-11-24 14:01:11részletek
612fellepo.huMihalik Béla Csaba2014-11-17 14:01:10részletek
613felnottbalett.huNagy-Hegyi Richárd2014-11-21 19:01:18részletek
614feloras.huCsontos István2014-11-19 14:01:22részletek
615femme.huSzmola Erika2014-11-19 14:01:16részletek
616festekwebbolt.huPoli-Farbe Kft.2014-11-17 19:01:18részletek
617feszek-ingatlan.huBooster Média Marketing Szolgáltató Kft.2014-11-20 14:01:04részletek
618fémdetektor.huDETECT MAX HUNGARY Kft.2014-11-17 19:01:02részletek
619fhtd.huFülep Dávid2014-11-21 19:01:16részletek
620fiataltehetsegekertalapitvany.huFiatal Tehetségekért Alapítvány2014-11-18 19:01:04részletek
621ficur.huFüzesséry Anikó2014-11-19 23:01:03részletek
622ficurapacban.huFüzesséry Anikó2014-11-19 23:01:03részletek
623filmbackground.huFilm Background Kft.2014-11-20 19:01:13részletek
624firststep-app.huDr. Tilinger Attila2014-11-21 14:01:25részletek
625fish-n-tech.co.huCsiba Gergely2014-11-19 14:01:02részletek
626fish-n-tech.huCsiba Gergely2014-11-19 14:01:03részletek
627fishntech.co.huCsiba Gergely2014-11-20 14:01:01részletek
628fishntech.huCsiba Gergely2014-11-19 14:01:20részletek
629fitmoka.huGolden Highway KFT2014-11-19 14:01:04részletek
630fitt-dancearena.huVidám Mária2014-11-21 19:01:16részletek
631fittmoka.huGolden Highway KFT2014-11-19 14:01:05részletek
632fizessokosan.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
633fler.huKrix Zoltán2014-11-19 19:01:16részletek
634flexfitness.huFarkas Gábor2014-11-21 19:01:04részletek
635florabalance.huGoodwill Pharma Orvos és Gyógyszertudományi Kereskedelmi és Szolgáltató Kft.2014-11-21 14:01:08részletek
636fodel.huHofer Sándor2014-11-19 14:01:08részletek
637fodraszpenztargepek.huNazza Software Kft.2014-11-17 19:01:13részletek
638fogadaspont.huKrix Zoltán2014-11-19 19:01:07részletek
639fogas.huKiss Péter2014-11-10 14:01:12részletek
640fogcomputing.huFaragó Róbert2014-11-18 23:01:17részletek
641fogfeheritesfehervar.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-24 14:01:17részletek
642fogszabalyozas-otthon.huArany Generáció Kft.2014-11-20 19:01:12részletek
643fogszabalyozasszekesfehervaron.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:03részletek
644fogyizo.huTerra Herba Kft.2014-11-19 14:01:21részletek
645foigazgato.huDr.Bedros J. Róbert2014-11-24 14:01:22részletek
646folyamituzoltosag.huZotmund Pál2014-11-17 14:01:06részletek
647foniciachange.huFőnicia Cash Change Kft2014-11-20 19:01:13részletek
648fontanetmedia.huVajk László2014-11-21 19:01:11részletek
649foodintertrade.huFood Intertrade Kft.2014-11-20 19:01:16részletek
650forcenix.huForcenix Solutions Kft2014-11-21 14:01:08részletek
651foreigners.huForeigners.cz, s.r.o.2014-11-24 14:01:13részletek
652foresightsports.huNoramtech Bt.2014-11-18 23:01:05részletek
653forintfitnesz.huHuszthy Gergely Balázs2014-11-18 14:01:03részletek
654formiko.huFormiko Kft2014-11-19 23:01:03részletek
655forside.huDuna House Franchise Kft.2014-11-21 14:01:13részletek
656fortepiano.huBalogh Csaba2014-11-20 14:01:02részletek
657forthekids.huDenke Dániel2014-11-19 14:01:19részletek
658fortuna-ingatlan.huFortuna Ingatlan és Hiteliroda2014-11-19 19:01:20részletek
659foto64.huBarna Buxbaum2014-11-19 19:01:13részletek
660fotoslany.huMegoldás Webügynökség Kft.2014-11-20 14:01:04részletek
661fotosvagyok.huRozsnyai Zsolt2014-11-18 14:01:08részletek
662fozo-ust.huIstella Tamás2014-11-18 14:01:25részletek
663fozomania.huVereb Adrienn2014-11-20 19:01:03részletek
664franciae-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
665franciaforditas.huKiss-Boros Beatrix2014-11-19 14:01:18részletek
666frenchbulldogs.huFlashdigital Bt.2014-11-19 23:01:08részletek
667frendy.huGebi Hungary Kft2014-11-19 14:01:02részletek
668frendywendy.huGebi Hungary Kft2014-11-19 14:01:13részletek
669freshmood-design.huCsapó Zsuzsanna2014-11-18 23:01:24részletek
670frima.huKombi Plusz Kft2014-11-17 14:01:04részletek
671fritzland.huHorváth-Hegyi Dénes2014-11-19 19:01:21részletek
672fuggonyfal.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
673fuggonyfalak.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
674fuggonyfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:21részletek
675fuggonyfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:14részletek
676fullarts.huKrix Zoltán2014-11-19 19:01:07részletek
677fundance.huMelkvi Zsuzsa2014-11-21 14:01:02részletek
678funds4i.huVicze Gabor2014-11-18 14:01:16részletek
679funkymonkeymedia.huRusznak Laszlo2014-11-21 14:01:06részletek
680furgonbolt.huBelus Zsolt2014-11-21 23:01:02részletek
681futesalkatresz.huTHERMO-SZERVIZ Kft.2014-11-21 19:01:16részletek
682futopanelaruhaz.huPelle és Pelle Kft.2014-11-18 23:01:10részletek
683futopaneluzlet.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
684futopolok.huIguana Computers Bt.2014-11-21 14:01:22részletek
685fuvarszerzes.huKontroll Média Kft2014-11-24 14:01:10részletek
686fx21.huRozgonyi György2014-11-20 19:01:08részletek
687g-styleforyou.huMuhi Gabriella2014-11-19 19:01:12részletek
688gabormiklos.huGábor Katalin2014-11-18 14:01:24részletek
689gabrieltemetkezes.huBrill Life Média Kft.2014-11-21 19:01:08részletek
690gadgetminutes.huUram János2014-11-21 14:01:21részletek
691galbalazs.huGál Balázs2014-11-20 14:01:04részletek
692galga-zagyva.huLantos Éva2014-11-19 23:01:05részletek
693gamberhosting.huKrix Zoltán2014-11-19 19:01:21részletek
694gammaplus.huOstrogonac József2014-11-20 19:01:01részletek
695gardrob.huKiberNet Kft.2014-11-18 19:01:02részletek
696gas-go.huGas-Go Magyarország Kft.2014-11-20 19:01:04részletek
697gastromuhely.huMohácsi Gábor2014-11-21 14:01:22részletek
698gastropapa.huWinkler László2014-11-21 14:01:29részletek
699gasztroda.huSzőke Mihály István2014-11-20 19:01:13részletek
700gasztromuhely.huMohácsi Gábor2014-11-21 14:01:01részletek
701gather.huEcsedi Ádám2014-11-17 19:01:19részletek
702gazhalozatszerelo.huFarkas Zsolt2014-11-19 19:01:19részletek
703gazkeszulekbudapest.huIzsold János2014-11-20 14:01:10részletek
704gdse.huLukács Gábor2014-11-17 14:01:24részletek
705gebi.huGebi Hungary Kft2014-11-19 14:01:07részletek
706geodrone.huGeomentor Kft2014-11-18 14:01:15részletek
707geopolitics.huWiking Számítástechnika Kft2014-11-18 23:01:13részletek
708gepsortelepites.huMegakrán Kft2014-11-24 14:01:09részletek
709gergelysanyi.huGergely Sándor2014-11-20 19:01:21részletek
710geszlerkft.huGeszler Kft.2014-11-18 14:01:14részletek
711getsportjob.huWebsupport s.r.o.2014-11-20 19:01:04részletek
712giftshopping.huWebsupport s.r.o.2014-11-17 19:01:05részletek
713gledita.huVarga Edit2014-11-24 14:01:24részletek
714glimark.huKovács Imre2014-11-18 23:01:06részletek
715glitter.huPekárovics Gábor2014-11-19 14:01:06részletek
716globalsummit.huBalogh Sándor2014-11-17 14:01:20részletek
717glosbe.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
718gmtscomm.huGMTS COMM Kft2014-11-19 14:01:13részletek
719goazis.huVajda Péter2014-11-17 19:01:11részletek
720gobliners.huCsanádi Viktor2014-11-20 19:01:13részletek
721goldenmeanaudit.huGolden Mean Audit Kft.2014-11-24 14:01:18részletek
722goldenstar.huPápai Petra2014-11-20 14:01:15részletek
723goldicon.huOroszi Károly2014-11-18 14:01:29részletek
724gomarketmail.huWebmédia Market Kft.2014-11-19 14:01:10részletek
725gombnyomasra.huKaraba György2014-11-20 14:01:07részletek
726gombsulyzo.huIllés László2014-11-19 14:01:22részletek
727goncbolha.huPC-Fenomén Kft.2014-11-17 19:01:12részletek
728gondolkodjunkegyutt.huKrix Zoltán2014-11-19 19:01:10részletek
729gondozohaz.huUnidomain Kft.2014-11-17 14:01:06részletek
730goodmorningbudapest.huKrix Zoltán2014-11-19 19:01:04részletek
731googlebolt.huMegaline Stúdió Kft.2014-11-19 19:01:04részletek
732goulashchef.huAgrocorp Consulting Kft2014-11-21 14:01:30részletek
733goulashinstitute.huAgrocorp Consulting Kft2014-11-21 14:01:26részletek
734gourmetboutique.huGRAPIXX HOSTING KFT.2014-11-17 19:01:12részletek
735grafikaszak.huHurton Tamás2014-11-18 23:01:20részletek
736grandechico.hu Berger Gasztro Kft.2014-11-17 14:01:10részletek
737grappalive.huHorváth Tamás2014-11-24 14:01:04részletek
738gravirfalva.huKovács Szabolcs2014-11-19 14:01:19részletek
739green-cars.huGreen Travel Nemzetközi Utazási Iroda Kft.2014-11-24 14:01:27részletek
740greenlandarea.huKovács Csaba2014-11-20 14:01:07részletek
741greenvulcano.huBusiness Innovant Kft.2014-11-18 14:01:16részletek
742grill-sziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:10részletek
743grillsziget.huAmbrusz Gergő Zsolt2014-11-19 23:01:09részletek
744gromatea.huGrófi Major Kft.2014-11-19 14:01:05részletek
745group7.huVárkonyi Attila2014-11-24 14:01:26részletek
746grundigshop.huBreyer Balázs2014-11-11 19:01:12részletek
747gsb.huBrankovics Gábor 2014-11-24 14:01:03részletek
748gtconsulting.huGergály Tamás2014-11-16 19:01:05részletek
749gumicukor.huCetinje s.r.o.2014-11-24 14:01:01részletek
750gyemanthomoki.huKrix Zoltán2014-11-19 19:01:09részletek
751gyemantmezo.huNetworking Kelet-Magyarország Kft.2014-11-17 19:01:16részletek
752gyerehozzamfelesegul.huDr.Bedros J. Róbert2014-11-24 14:01:10részletek
753gyerekagybolt.huNapjaink Kft.2014-11-18 23:01:19részletek
754gyerekágybolt.huNapjaink Kft.2014-11-18 23:01:20részletek
755gyerekjátékshop.huHajnal Zsombor EV2014-11-17 19:01:19részletek
756gyerekzokini.huÖko-PC Kft.2014-11-21 19:01:15részletek
757gyermekfantazia.huAntal Ferencné2014-11-21 14:01:10részletek
758gyermekfogaszatszekesfehervar.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:09részletek
759gyermekmegtakaritas.huMesszi-Szabó Gábor2014-11-19 19:01:05részletek
760gyiq.huŐcsi Balázs E.V.2014-11-21 14:01:28részletek
761gymready.huKatschthaler Gabriella2014-11-19 14:01:17részletek
762gyogylaser.huBálint Imre2014-11-17 19:01:06részletek
763gyogynoveny.info.huGomoa Trade Kft2014-11-19 14:01:22részletek
764gyogyul.huUlicska Tamás2014-11-21 19:01:21részletek
765gyogyulni.huUlicska Tamás2014-11-21 19:01:21részletek
766gyongyszemmoletti.huBenda János Róbert2014-11-21 14:01:02részletek
767gyonimajor.huZlinszky Ferenc2014-11-16 19:01:02részletek
768gyoparos-terapia.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
769gyukadental.huGyuka-Dental Kft.2014-11-19 14:01:11részletek
770habi-epker.huHabi-Épker Kft.2014-11-18 23:01:06részletek
771haccpkezikonyv.huT&M Műszaki Szolgáltató Kft.2014-11-24 14:01:03részletek
772haccpszabalyzat.huT&M Műszaki Szolgáltató Kft.2014-11-24 14:01:03részletek
773hadnagydesign.huHadnagy Sándor egyéni vállalkozó2014-11-24 14:01:20részletek
774hair4u.huHD Group Kommunikacios Ugynokseg Kft.2014-11-17 14:01:12részletek
775hajdusagisorstarsak.huHajdúsági Sorstársak Együtt Egymásért Egyesülete2014-11-17 14:01:07részletek
776hajszalhijjan-jog.huAnonymouse Domains s.r.o.2014-11-20 19:01:09részletek
777halkalauz.huJónap Richárd2014-11-17 19:01:04részletek
778hamleys.co.huHamleys of London Ltd.2014-11-19 23:01:05részletek
779hangulatvarazs.huPilling Tünde2014-11-19 14:01:07részletek
780hannapalinka.huÁsványi Anikó2014-11-21 14:01:05részletek
781hantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:14részletek
782happyfoodcoffee.huHappy Food & Coffee Kft2014-11-19 19:01:18részletek
783hardwareonline.huKrix Zoltán2014-11-19 19:01:11részletek
784harkany.hotel.huPaqart design Kft.2014-11-17 14:01:07részletek
785harmoniasarok.huPapp Anikó Míra2014-11-24 14:01:25részletek
786harsanyiistvandij.huManager Képzés Alapítvány2014-11-20 14:01:03részletek
787hasznalt-fenymasolok.huProfil-Copy 2002 Kft.2014-11-17 14:01:02részletek
788hazbolt.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
789hazweb.huGerbner Dániel Ádám2014-11-24 14:01:26részletek
790hazwebaruhaz.huGerbner Dániel Ádám2014-11-24 14:01:08részletek
791házipornó.huDiczkó Csaba2014-11-21 14:01:15részletek
792hegesztesmiskolc.huSzilágyi Zoltán 2014-11-24 14:01:09részletek
793heilung.huUlicska Tamás2014-11-21 19:01:11részletek
794helenaszappan.huBlind Bt. 2014-11-21 14:01:13részletek
795helibudapest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
796helipest.huFortis Solutio Kft.2014-11-18 14:01:26részletek
797hellotelo.huHellotelo Telekommunikációs Kft.2014-11-22 23:01:02részletek
798helperek.huDr. Szeles Géza EV2014-11-21 14:01:17részletek
799helpme.huNetworKing Informatika Kft.2014-11-17 19:01:09részletek
800herba-tunder.huTelekom-Line Kft.2014-11-24 14:01:21részletek
801herbariabalance.huChrien Károly2014-11-19 14:01:04részletek
802herbatunder.huTelekom-Line Kft.2014-11-20 19:01:12részletek
803heshunfa.huHeshunfa Kft.2014-11-21 14:01:17részletek
804hetimenu.huSimó István2014-11-21 14:01:23részletek
805hetret.huKrix Zoltán2014-11-19 19:01:08részletek
806hetta.huHepp Brigitta2014-11-18 14:01:24részletek
807hidraulikajaszbereny.huSzele-Főnix Kft.2014-11-18 14:01:18részletek
808hifanovenyvedoszerkereskedelem.huZEMPLÉN-MAG Kft.2014-11-19 19:01:04részletek
809highfashion.huEuroDNS S.A.2014-11-17 14:01:23részletek
810hintaló.huFehér Zsolt2014-11-20 14:01:03részletek
811hiperdonkey.huWebsupport s.r.o.2014-11-22 23:01:01részletek
812hiperhaver.huHiper-Aktív Family Kft2014-11-20 14:01:02részletek
813hirekazorszagbol.huSWA Szervíz Kft2014-11-17 19:01:14részletek
814hirekelsokezbol.huSWA Szervíz Kft2014-11-17 19:01:15részletek
815hirlevel-kikuldes.huBoardland.hu Kft. 2014-11-20 19:01:22részletek
816hitelmonitor.huRácz Attila2014-11-21 19:01:12részletek
817hivatalosforras.huMárton Géza2014-11-21 14:01:11részletek
818hnkozetkeztetes.huTóth Imre2014-11-19 19:01:11részletek
819ho-ho.huNagyné Herczeg Eszter2014-11-19 14:01:15részletek
820hobbikezilabda.huSWA Szervíz Kft2014-11-17 19:01:14részletek
821holmosassak.huTyimofejev Gábor 2014-11-24 14:01:12részletek
822homebeer.huRácz Dávid2014-11-21 14:01:20részletek
823homepilates.huKocsis Katalin2014-11-20 19:01:19részletek
824hondakalogep.huKaló István2014-11-18 23:01:09részletek
825honlapkesziteskecskemet.huGalocaffe KFT2014-11-24 14:01:05részletek
826honlapszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
827honlaptervezok.huD-Com Group Kft2014-11-17 19:01:16részletek
828hontvari.huKovácsné Hontvári Krisztina2014-11-19 14:01:07részletek
829honvedelemertklub.huMihályi Produkció KFT.2014-11-21 14:01:01részletek
830hooh.huMayer Norbert2014-11-18 23:01:04részletek
831hopika.huIllyés Dezsõ2014-11-19 19:01:03részletek
832horfa.huHorváth György2014-11-18 14:01:16részletek
833horgasztaborok.huGeicz-Molnár Szilvia2014-11-18 23:01:09részletek
834horgolt.huCogitate Games Kft.2014-11-19 19:01:18részletek
835hornetklub.huWebsupport s.r.o.2014-11-24 14:01:27részletek
836horvateskuvo.huSzabó László2014-11-18 14:01:07részletek
837horvathszervizmihalyi.huBedi Ervin E.V.2014-11-20 14:01:07részletek
838hpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
839hpu.huUnidomain Kft.2014-11-19 19:01:15részletek
840hualan.huHualan Kft.2014-11-21 14:01:04részletek
841hugs.huLenka Baldrianova2014-11-18 14:01:27részletek
842humydry.huEuroDNS S.A.2014-11-18 23:01:12részletek
843hungarizalj.huSzabó Balázs Ev.2014-11-18 23:01:16részletek
844hungarymail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
845hungarytrip.huBenedek Csilla2014-11-20 14:01:07részletek
846hunpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
847hunyadygabor.huConsult Unio Kft2014-11-18 14:01:21részletek
848hunyatefu.huKrix Zoltán2014-11-19 19:01:09részletek
849hurrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
850hürrem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
851hyperdonkey.huWebsupport s.r.o.2014-11-24 14:01:11részletek
852i-partner.huPelican System Kft.2014-11-20 19:01:10részletek
853iberianfoods.huEuroDNS S.A.2014-11-17 14:01:02részletek
854icamamahusboltja.huBia-Dia Faloda Kft2014-11-18 14:01:19részletek
855icomplete.huWhite Fluffy Cloud Limited2014-11-17 14:01:10részletek
856icrypt.huINTEGRITY Kft.2014-11-20 19:01:22részletek
857ideveled.huKhaut Zsolt2014-11-21 14:01:18részletek
858idezetbolt.huFeki Webstudio Kft.2014-11-19 19:01:07részletek
859idezetportal.huFeki Webstudio Kft.2014-11-19 19:01:06részletek
860idezetshop.huFeki Webstudio Kft.2014-11-19 19:01:18részletek
861idezettar.huFeki Webstudio Kft.2014-11-19 19:01:17részletek
862idojaras-sopron.huHelyes Gábor2014-11-20 19:01:06részletek
863idromatic.huNatur Wash Kft.2014-11-19 14:01:10részletek
864ieskft.huIpari Elektronikai Szervíz Kft.2014-11-18 14:01:18részletek
865iexpress.huRocskar Tibor2014-11-17 14:01:23részletek
866igazmese.huKiss Erzsébet2014-11-19 14:01:15részletek
867ikerhaz.huCetinje s.r.o.2014-11-24 14:01:02részletek
868ikerhazak.huCetinje s.r.o.2014-11-24 14:01:06részletek
869imatic.huSólyomi Gábor2014-11-21 14:01:26részletek
870imcsi.huKöő Imre2014-11-18 23:01:22részletek
871imperialairsoft.huVárkonyi Zsolt Attila2014-11-21 14:01:09részletek
872impulsefitclub.huKisdaróczy Gábor2014-11-19 23:01:08részletek
873incipio.co.huEuromarknet Kft. (Registrar)2014-11-15 14:01:02részletek
874independencekey.huKocsis Tamás2014-11-17 19:01:17részletek
875industrial-property.co.huIndustrial-Property Kft2014-11-21 14:01:18részletek
876info-központ.huMéta Kereskedelmi Kft.2014-11-19 14:01:16részletek
877infoksport.huSWA Szervíz Kft2014-11-17 19:01:14részletek
878infoter.huCetinje s.r.o.2014-11-22 23:01:01részletek
879ingatlan-balaton.huKovács Attila2014-11-18 14:01:09részletek
880ingatlan-guru.huPethő Eszer2014-11-20 14:01:08részletek
881ingatlan-ker.huGigaweb Kft2014-11-18 14:01:24részletek
882ingatlanconsulting.huNRG-TECH GLOBAL Kft.2014-11-17 19:01:01részletek
883ingatlanmobil.huDr Várhegyi Ügyvédi Iroda2014-11-17 14:01:09részletek
884ingyenporno.co.huBuzsik Róbert2014-11-21 19:01:15részletek
885injex.huDr. Antolik Marianna2014-11-21 19:01:07részletek
886innobyte.huInnobyte Informatikai Korlátolt Felelősségű Társaság2014-11-21 19:01:04részletek
887innoco.huDr. Fekete Róbert Tamás2014-11-21 14:01:05részletek
888integralmedia.huInvestment Marketplace Zrt.2014-11-21 14:01:11részletek
889intellegoextra.huCzellár István Zénó2014-11-21 19:01:13részletek
890intellicon.huOrosz Péter2014-11-17 19:01:07részletek
891intermail.huTablet-Discount Kft.2014-11-19 14:01:05részletek
892internetespenzkereses.huFülöp Márk2014-11-24 14:01:17részletek
893interplex.co.huInterplex Hungary, Kft.2014-11-18 14:01:24részletek
894intertrade.huVeres Tamás2014-11-21 14:01:29részletek
895intimajandek.huIllés Krisztina2014-11-21 14:01:05részletek
896intimtorna-budapest.huIlok-Székely Zsanett2014-11-18 19:01:05részletek
897investola.huSteier Márton2014-11-18 19:01:07részletek
898iparifutesek.huPelle és Pelle Kft.2014-11-18 23:01:09részletek
899ipole.huUdvardy Sára2014-11-17 19:01:13részletek
900iq-szerviz.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:16részletek
901iqszervizkft.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:18részletek
902irenkesegit.huMárkus Ágnes2014-11-20 14:01:08részletek
903iroda-guru.huPethő Eszer2014-11-20 14:01:08részletek
904irodakraktarak.huHarkácsi István2014-11-20 19:01:09részletek
905ispot.huNagy-Barta József2014-11-21 19:01:20részletek
906istvankalmar.huKalmár István2014-11-18 23:01:24részletek
907it-happens.huIT-HAPPENS Kft.2014-11-19 23:01:08részletek
908itacademy.huKrix Zoltán2014-11-19 19:01:09részletek
909itart.huSzták András2014-11-20 14:01:12részletek
910itcegek.huwebformance Kft.2014-11-20 19:01:08részletek
911itechshop.huItech-Sales Kft.2014-11-24 14:01:27részletek
912ittours.huIT Tours Korlátolt Felelősségű Társaság2014-11-24 14:01:22részletek
913ityuk.huWebsupport s.r.o.2014-11-17 14:01:19részletek
914iyassu.huBerenyi Rita2014-11-20 19:01:20részletek
915janafoto.huVarga-Kovács Janka 2014-11-19 23:01:07részletek
916jannus.huCsillag Kiadó Kft.2014-11-18 14:01:04részletek
917jarmuvetel.huA111 Autó Kft.2014-11-18 23:01:15részletek
918javaszoftverfejlesztes.huSinkovits Balázs2014-11-20 19:01:16részletek
919jazminpakoca.huRemetei Tamás2014-11-19 19:01:19részletek
920jazzlexikon.huFenyős Zoltán2014-11-21 14:01:04részletek
921jbdesign.huMihalics Bernadett2014-11-19 19:01:22részletek
922jeebalaton.huKrix Zoltán2014-11-19 19:01:09részletek
923jelgyar.huMolnár Balázs2014-11-24 14:01:23részletek
924jobtogo.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
925jogalap.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:16részletek
926jogaswing.huZYD-Szer Kft.2014-11-18 14:01:06részletek
927jogkozpont.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:17részletek
928jogporta.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:28részletek
929jogszinter.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:01részletek
930jogterulet.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:16részletek
931jogweb.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:17részletek
932johirnevklub.huTóth Zoltán2014-11-18 23:01:02részletek
933johnnybudapest.huWezz Informatikai Kft 2014-11-18 14:01:08részletek
934josef.huUnidomain Kft.2014-11-19 19:01:03részletek
935jovofutese.huPelle és Pelle Kft.2014-11-18 23:01:08részletek
936jucuskonyhája.huFleischmann Pál2014-11-17 14:01:20részletek
937jujitsunyh.huBélteczki Csaba2014-11-20 19:01:18részletek
938jumbomedia.huSzabó Tamás2014-11-19 14:01:22részletek
939jumbó.huSzabó Tamás2014-11-19 14:01:08részletek
940jumbómédia.huSzabó Tamás2014-11-19 14:01:08részletek
941jungleindabox.huMIKROLAB S.r.o.2014-11-24 14:01:14részletek
942justnatural.huNagyné Csorba Zsuzsanna2014-11-18 14:01:16részletek
943kacagok.huKontroll Média Kft2014-11-24 14:01:07részletek
944kacagokacat.huEncziné Varga Andrea2014-11-17 19:01:21részletek
945kacagunk.huKontroll Média Kft2014-11-24 14:01:08részletek
946kacsalla.huHATALA ZSOLT2014-11-18 19:01:03részletek
947kajdicomputer.huKajdi Roland2014-11-20 14:01:03részletek
948kalamarbeata.huKalamár Beáta ev.2014-11-19 23:01:10részletek
949kalapbar.huTerra-Pia Kft.2014-11-24 14:01:22részletek
950kalapozz.huMészáros Gábor2014-11-19 14:01:17részletek
951kalauzhal.huJónap Richárd2014-11-20 19:01:15részletek
952kamion-alkatresz.huVér József2014-11-19 19:01:14részletek
953kamionosakademia.huLaczházy Sebastian2014-11-24 14:01:23részletek
954kamionreklam.huWalking Image Kft.2014-11-20 19:01:03részletek
955kampanykezeles.huMagyari Annamária2014-11-21 19:01:15részletek
956kaposvariprogramok.huFenyő Zsuzsanna2014-11-21 14:01:12részletek
957kapro.huTOOL JÓ Nagykereskedelmi Korlátolt Felelősségű Társaság2014-11-24 14:01:04részletek
958kapszegyfulest.huTV2 Média Csoport Kft.2014-11-21 14:01:02részletek
959karacsony2014.huMészáros Gábor2014-11-19 14:01:21részletek
960karaszutca.huDr. Módra Szilvia2014-11-21 19:01:09részletek
961karcagi-peter.huCogitate Games Kft.2014-11-18 14:01:29részletek
962karmablog.huTarnai Akos2014-11-18 14:01:03részletek
963karmakeramia.huYellow Consulting Kft.2014-11-19 14:01:12részletek
964kaszanyidora.huKaszanyi Dóra2014-11-17 14:01:16részletek
965katkawebdesign.huNagy Katalin2014-11-19 19:01:06részletek
966kekeper.huKovács Zoltán EV2014-11-19 14:01:13részletek
967keklagunahaz.huBest-Impex Kft2014-11-20 19:01:20részletek
968kekpiramis.huTechcentral Kft.2014-11-17 23:01:02részletek
969keleterintese.huSzőke Attila2014-11-17 19:01:16részletek
970keleticsucsok.huBusiness Innovant Kft.2014-11-18 14:01:18részletek
971keleticsücsök.huBusiness Innovant Kft.2014-11-18 14:01:06részletek
972kelloggsvantage.huKellogg Europe Trading Limited2014-11-19 19:01:16részletek
973kepfelho.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
974keramixlighting.huKeramix Hungary Kft.2014-11-20 19:01:13részletek
975keretklub.huFinalArt Studio Kft.2014-11-19 14:01:21részletek
976kertalkotok.huMándoky Petra Dorottya 2014-11-17 23:01:02részletek
977kettlebellakademia.huIllés László2014-11-18 23:01:02részletek
978ketuszkapuvar.huMedSol Expert Kft.2014-11-21 19:01:11részletek
979ketyego.huPapp Gábor2014-11-24 14:01:13részletek
980kezsuvedelem.huKencse Zsuzsanna2014-11-21 14:01:04részletek
981képestok.huEz GSM Phone Kft.2014-11-19 23:01:03részletek
982kgstpiac.huKaczur Tibor2014-11-17 14:01:18részletek
983kilincsdesign.huB&M Mechanika Kft.2014-11-17 19:01:22részletek
984killercv.huSzulyovszky Lilla2014-11-21 19:01:10részletek
985kinesiology-tape.huM and M Interconsulting Bt.2014-11-18 23:01:09részletek
986kineziologiai-tapasz.huM and M Interconsulting Bt.2014-11-18 23:01:07részletek
987kinxstudio.huMounier Stephane Jean Pierre2014-11-21 14:01:18részletek
988kisit.huKis Norbert2014-11-20 14:01:04részletek
989kiskom.huKis Norbert2014-11-17 19:01:16részletek
990kislan.huKis Norbert2014-11-17 19:01:15részletek
991kisnemes.huNemes Attila2014-11-21 23:01:01részletek
992kispince.huKis Csaba2014-11-17 14:01:14részletek
993kisugarzas.huKardos Levente2014-11-18 19:01:06részletek
994kisvállalatirendszergazda.huSURIEL Informatikai Kft.2014-11-21 14:01:27részletek
995kitsimono.huTirpák Bálint Gábor2014-11-18 23:01:14részletek
996kiwisuncosmetics.huHI-RE Kft2014-11-17 23:01:01részletek
997klinkercentrum.huTetőcentrum Magyarország Kft.2014-11-20 14:01:15részletek
998koborgo.huKiss Imre E.V.2014-11-19 14:01:20részletek
999kockasfuzet.huKarpf Sándor2014-11-21 23:01:01részletek
1000kockatomb.huNagy Tibor2014-11-17 14:01:13részletek
1001kockerd.huSzilágyi Antal2014-11-19 14:01:09részletek
1002koltsegcsokkento.huUnidomain Kft.2014-11-19 19:01:13részletek
1003kombinalthitel.huIntec Online Kft. (Registrar)2014-11-24 14:01:23részletek
1004kommunalistechnika.huOpal Média és Kommunikáció Bt.2014-11-21 19:01:20részletek
1005kompetenspedagogus.huArató Ferenc2014-11-20 19:01:09részletek
1006konarch.huKomódi Gergő Norbert2014-11-24 14:01:11részletek
1007kondiguru.huKELET-TANÉRT Kft.2014-11-21 14:01:14részletek
1008kondorj.huKondor János2014-11-24 14:01:10részletek
1009kondorosikk.huKondorosi Kézilabda Klub2014-11-21 19:01:03részletek
1010kondorosikonyvtar.huDérczy Ferenc Könyvtár és Közművelődési Intézmény2014-11-21 14:01:16részletek
1011konnyentanulas.huKrix Zoltán2014-11-19 19:01:14részletek
1012kontinum.huKONTINUM Kft.2014-11-18 23:01:21részletek
1013konyveloszentendren.huDominó 5/1 Kft2014-11-21 19:01:14részletek
1014konyvetjoaron.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:25részletek
1015konyvkoto.huBártfai Balázs2014-11-18 14:01:16részletek
1016konyvtenger.huTimár Mátyás2014-11-19 14:01:05részletek
1017korall-szepsegszalon.huVarga- Kovács Nikolett2014-11-17 14:01:23részletek
1018korall-zazo.huZAZO Innovációs Holding Kft2014-11-17 19:01:07részletek
1019korgforum.huDetvai Gyula2014-11-20 19:01:02részletek
1020kornyezettudatos.huKump Edina2014-11-17 19:01:23részletek
1021koronakavehaz.huOpenLocal Kft.2014-11-24 14:01:21részletek
1022korosietterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:21részletek
1023korruptkormany.huLeft-Wing Network Ltd2014-11-17 14:01:08részletek
1024korsal.huSütő-Nagy Borbála2014-11-17 14:01:13részletek
1025kosem.huTrivium Kiadó Kft.2014-11-17 14:01:21részletek
1026koserpita.huSemes B'H Kft2014-11-21 14:01:26részletek
1027kotai.huUnidomain Kft.2014-11-17 19:01:14részletek
1028kották.huCsipai Roland2014-11-19 19:01:15részletek
1029kovacsoltvasmiskolc.huKertész István2014-11-24 14:01:24részletek
1030kozelhozzank.huGorea Loreta2014-11-21 19:01:20részletek
1031kozmetikuspenztargepek.huNazza Software Kft.2014-11-17 19:01:17részletek
1032kozosenmagyarorszagert.huKirály Béla2014-11-19 14:01:21részletek
1033kölyökatlétika.huScheidler Géza2014-11-21 14:01:08részletek
1034könyvetjóáron.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:11részletek
1035körsál.huSütő-Nagy Borbála2014-11-18 23:01:20részletek
1036kösem.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1037kreateve.huRöhricht Szabolcs2014-11-16 19:01:06részletek
1038kredencjava.huBusiness Innovant Kft.2014-11-18 14:01:15részletek
1039krisztidesign.huSzelényi Krisztina2014-11-19 19:01:10részletek
1040kriszwebdesign.huErdélyi Krisztián2014-11-19 19:01:22részletek
1041kronikakonyvesbolt.huIntec Online Kft. (Registrar)2014-11-18 19:01:05részletek
1042kronikasa.huCsordás Zoltán2014-11-18 14:01:25részletek
1043kross-kerekpar.huBartusné Petkó Marietta2014-11-19 14:01:07részletek
1044ktva.huKözép-Tiszai Vidékfejlesztő Alapítvány2014-11-19 19:01:02részletek
1045kukorica-olaj.huBalogh Levente2014-11-24 14:01:04részletek
1046kuldetesunk.huTóth Balázs2014-11-21 14:01:13részletek
1047kulsoertekeles.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:19részletek
1048kuponajandeka.huKrix Zoltán2014-11-19 19:01:09részletek
1049kuponozon.huNV SPEED KFT.2014-11-21 14:01:24részletek
1050kutklima.huKeresztes László2014-11-19 14:01:02részletek
1051kutyanevek-nevnapok.huNagy Gábor2014-11-19 19:01:14részletek
1052kutyaneveknevnapok.huNagy Gábor2014-11-19 19:01:15részletek
1053kzsdesign.huKozák Zsanett2014-11-19 19:01:05részletek
1054lachmann1886.huLachmann Anno 1886 Kft.2014-11-24 14:01:23részletek
1055lacibetyarfogado.huEcoclean Hungária Szolgáltató és Kereskedelmi Kft.2014-11-24 14:01:21részletek
1056lagunahome.huP.R. Fürdőszoba Kft.2014-11-17 19:01:12részletek
1057lajkolja.huSOS Egyesület2014-11-24 14:01:06részletek
1058lajkoljad.huSOS Egyesület2014-11-24 14:01:06részletek
1059lajkolunk.huSOS Egyesület2014-11-24 14:01:05részletek
1060lakas-guru.huPethő Eszer2014-11-21 14:01:08részletek
1061lakashitelmonitor.huRácz Attila2014-11-21 19:01:11részletek
1062lakashotel.huKovács Szabolcs Pál2014-11-19 23:01:04részletek
1063lakashotelek.huKovács Szabolcs Pál2014-11-19 23:01:05részletek
1064lakasvadaszat.huTonic Reklám Kft.2014-11-24 14:01:05részletek
1065lakolap.huGerbner Dániel Ádám2014-11-19 23:01:03részletek
1066lanora.huLanora Solution Kft.2014-11-24 14:01:11részletek
1067laptopsuli.huLauritzen Instore Kft.2014-11-21 14:01:29részletek
1068laptopszervizszolnok.huADACSA Kft.2014-11-18 14:01:27részletek
1069lashandnail.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:18részletek
1070lashvolution.huJPT Investment Partners Limited2014-11-21 19:01:02részletek
1071lat6lak.huDoka Norbert2014-11-21 14:01:13részletek
1072lcwaikiki.huLcWaikiki Magazacilik Ticaret As.2014-11-24 14:01:16részletek
1073learmorszakszervezet.huDanka Attila2014-11-18 14:01:28részletek
1074leboltgo.huX-Software Kft.2014-11-21 14:01:12részletek
1075ledekboltja.huGreen Plan Energy Kft 2014-11-19 23:01:09részletek
1076ledszpot.huWebsupport s.r.o.2014-11-24 14:01:16részletek
1077ledszpotlampa.huWebsupport s.r.o.2014-11-24 14:01:14részletek
1078ledtvszerviz.huKomlós Zsolt2014-11-20 19:01:06részletek
1079legiszabalyozas.huDeák András2014-11-24 14:01:14részletek
1080leglibirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:18részletek
1081leglibor.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:21részletek
1082legliotto.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:20részletek
1083legliszolobirtok.huLÉGLI SZŐLŐ ÉS BORTEMELŐ KFT.2014-11-19 14:01:19részletek
1084lego-webshop.huWebMeszler Kft.2014-11-10 14:01:59részletek
1085legszebbnapra.huMacsek Istvánné E.V.2014-11-21 14:01:24részletek
1086legterillatositas.huEmpresa Szolgáltató Bt2014-11-18 14:01:28részletek
1087legvar60.huBertók Máté2014-11-19 19:01:03részletek
1088legyelbator.huErdős Nóra2014-11-17 14:01:18részletek
1089legyelboldog.huErdős Nóra2014-11-17 14:01:03részletek
1090legyelegeszseges.huKrizsán Tamás2014-11-17 19:01:21részletek
1091lehneruveg.huLéhner Szilveszter2014-11-20 19:01:19részletek
1092lekocsma.huMuzslay Tamás2014-11-17 19:01:21részletek
1093lelekiranytu.huKovács Zsolt2014-11-20 14:01:14részletek
1094lelekvarazslat.huPilling Tünde2014-11-19 14:01:09részletek
1095lem2-gyor.huInfoartnet Kft.2014-11-18 23:01:03részletek
1096lenartgrafika.huLénárt Viktor2014-11-19 19:01:21részletek
1097lepkeovigyor.huTárogató Óvoda Lepke Tagóvodája 2014-11-18 14:01:23részletek
1098lifemaster.huMravik Zsolt2014-11-17 19:01:08részletek
1099liftkamerak.huBolemányi Tibor E.V2014-11-19 19:01:18részletek
1100lightandnature.huKrix Zoltán2014-11-19 19:01:13részletek
1101likebaby.huDevron-Impex Kft2014-11-19 14:01:18részletek
1102likeface.huKrix Zoltán2014-11-19 19:01:09részletek
1103limoforum.huKovács Imre2014-11-21 14:01:04részletek
1104lindt-shop.huDomain Robot Limited2014-11-16 19:01:02részletek
1105lindtshop.huDomain Robot Limited2014-11-16 19:01:03részletek
1106liquidsafe.huiHelpTrading Kft.2014-11-18 23:01:20részletek
1107livebudapest.huMedgyesi Zoltán2014-11-24 14:01:11részletek
1108lkwstore.huZsámbok János2014-11-20 19:01:18részletek
1109loginschool.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
1110loginsuli.huLauritzen Instore Kft.2014-11-21 14:01:15részletek
1111logopedia40.huAnonymouse Domains s.r.o.2014-11-24 14:01:02részletek
1112londonetterem.huTóth Attila2014-11-17 19:01:16részletek
1113londoniszallas.huSilicium Network Kft. (Registrar)2014-11-17 14:01:03részletek
1114loom-band.huVil-For Kft. 2014-11-21 19:01:17részletek
1115loom-bands.huVil-For Kft. 2014-11-21 19:01:20részletek
1116louisxivenergy.huMucsi Gergely2014-11-18 23:01:21részletek
1117lourdesviz.huNémeth Gyula2014-11-24 14:01:13részletek
1118lstm.huLSTM ipari, kereskedelmi és szolgáltató Kft.2014-11-21 14:01:19részletek
1119lukacsipapir.huLukácsi Mercédesz2014-11-20 14:01:08részletek
1120luxus-szonyeg.huVarga Gergő2014-11-20 19:01:15részletek
1121luxusszonyeg.huVarga Gergő2014-11-20 19:01:11részletek
1122lxy.huDömötör Tímea Zsuzsanna2014-11-18 14:01:02részletek
1123lyngsat.huEuroCable Magyarorszag Kft.2014-11-10 14:02:10részletek
1124m15residence.huM15 Villa Rezidencia Kft.2014-11-18 23:01:03részletek
1125m35.huUndefasa Kft. 2014-11-19 19:01:04részletek
1126maasdamer.huFoodnet Kft.2014-11-21 19:01:18részletek
1127maasdami.huFoodnet Kft.2014-11-21 19:01:18részletek
1128madohome.huDagdelen Emrah2014-11-18 19:01:03részletek
1129mafoakademia.huMagyarországi Foglalkoztatási és Oktatási Kft.2014-11-21 14:01:25részletek
1130mafoakadémia.huMagyarországi Foglalkoztatási és Oktatási Kft.2014-11-20 19:01:17részletek
1131mag250.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1132maganerdesz.huHorváth Gábor2014-11-19 14:01:13részletek
1133maganraktar.huBlinszki László2014-11-17 19:01:02részletek
1134magastatra.huPrime Media s.r.o.2014-11-22 23:01:02részletek
1135magmametal.huSzádvári Gábor 2014-11-20 19:01:09részletek
1136magnoliaekszer.huAbonyi-Szabó Emese2014-11-21 14:01:11részletek
1137magyarfotokabin.huVarga Toth Maria2014-11-17 14:01:01részletek
1138magyarrss.huKrix Zoltán2014-11-19 19:01:07részletek
1139mah-pyrogas-kazan.huMészáros Attila2014-11-20 14:01:06részletek
1140mailworx.hueworx Network & Internet GmbH2014-11-18 14:01:27részletek
1141majomlampa.huAu Cash Kft.2014-11-21 19:01:05részletek
1142majorfoldmunkak.huMajor Földmunkák Kft. 2014-11-21 14:01:28részletek
1143malimo.huRobonet BT2014-11-20 14:01:09részletek
1144mammutneckermannsport.huPartner Kft.2014-11-19 14:01:15részletek
1145mandateka.huMagyar Nemzeti Digitális Archívum és Filmintézet2014-11-21 19:01:03részletek
1146mango-masszazs.huBusiné Szilágyi Szilvia E.V.2014-11-21 19:01:13részletek
1147marcalihollandbutor.huBogár Richárd2014-11-21 19:01:19részletek
1148marinagold.huGalaxis Világa Kft2014-11-20 19:01:08részletek
1149marketinghaz.huKontroll Média Kft2014-11-24 14:01:06részletek
1150marketingido.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1151marketingstratega.huCT Consulting Central Europe Korlátolt Felelősségű Társaság2014-11-21 19:01:10részletek
1152masdamer.huFoodnet Kft.2014-11-21 19:01:18részletek
1153masdami.huFoodnet Kft.2014-11-21 19:01:17részletek
1154maspedlogisztika.huMasped Logisztika Logisztikai és Vámügynökségi Kft.2014-11-21 14:01:08részletek
1155masszazsterapiapecs.huHatházi Milán Attila2014-11-20 19:01:16részletek
1156masszorguru.huNothnágel Balázs2014-11-18 14:01:09részletek
1157masterbaits.huVeres Tamás E.v.2014-11-17 19:01:17részletek
1158masvagyok.huPapp Zsolt2014-11-17 14:01:21részletek
1159maszosz.huKrix Zoltán2014-11-19 19:01:08részletek
1160maszotars.huTájnel Gábor2014-11-17 19:01:11részletek
1161matiger.huElekes György2014-11-21 14:01:09részletek
1162matyasapartman.huPásztor Ádám2014-11-21 19:01:11részletek
1163meccskozpont.huKrix Zoltán2014-11-19 19:01:09részletek
1164medi-coach.huSzegény Beatrix2014-11-18 23:01:10részletek
1165medicalinvest.huGecsey Mihály2014-11-21 19:01:05részletek
1166medihol.huSzilágyi Informatika és Műszertechnika Kft.2014-11-17 19:01:07részletek
1167meditur.huAmber Industries Kft.2014-11-21 19:01:09részletek
1168megaclans.huTakács Kristóf2014-11-24 14:01:27részletek
1169meghatalmazas.huSántha György2014-11-22 23:01:02részletek
1170megoldasmediacio.huVégh János2014-11-17 19:01:22részletek
1171megosztok.huSOS Egyesület2014-11-24 14:01:04részletek
1172mentortext.huJanó Zoltán2014-11-17 19:01:06részletek
1173mentseletetkaracsonyra.huKreativ Kontroll Kft.2014-11-24 14:01:21részletek
1174mercymolnar.huMolnár Ferenc2014-11-20 19:01:02részletek
1175merlinszalon.huWorld-System kft.2014-11-18 14:01:08részletek
1176mester-fok.huSzabó Attila2014-11-18 23:01:22részletek
1177mesterhegedu.huLakatos Anna2014-11-19 14:01:07részletek
1178metalenprint.hu"METALEN" Nyomdaipari és kereskedelmi Kft.2014-11-21 14:01:21részletek
1179meteobox.huAliaWeb, Spol. S R.o.2014-11-21 14:01:24részletek
1180meteospasmyl.huSager Pharma Kft.2014-11-18 19:01:07részletek
1181metropolcenter.huMetropol Center Kft2014-11-19 14:01:03részletek
1182mezohegyesszakkepzeseert.huSzumaszi Bt.2014-11-18 14:01:25részletek
1183mélytorok.huDiczkó Csaba2014-11-20 19:01:11részletek
1184mics.huMICS-LINE Szolgáltató Bt.2014-11-19 19:01:10részletek
1185mikroszoft.huMikroszoft Fejlesztő és Kereskedelmi Kft.2014-11-19 19:01:04részletek
1186milasslim.huMilassin András2014-11-17 19:01:13részletek
1187militariatrend.huRoth Tamás2014-11-17 19:01:02részletek
1188military-vadasz.huBojtor Tamás2014-11-20 19:01:19részletek
1189milwaukeeszerszam.huDL'1 Villamossági Nagykereskedés Kft2014-11-12 14:01:17részletek
1190milyeniskolakell.huSzegedi Waldorf Társas Kör Egyesület2014-11-24 14:01:08részletek
1191milyenovodakell.huSzegedi Waldorf Társas Kör Egyesület2014-11-24 14:01:09részletek
1192mindenfoci.huSWA Szervíz Kft2014-11-17 19:01:07részletek
1193mindenholhal.huSzarvas-Fish Kft.2014-11-19 19:01:10részletek
1194mindenkönyv.huIQ Szerviz Könyvkereskedés Kft.2014-11-21 14:01:12részletek
1195mindignyerj.huCardComp Product Kft.2014-11-24 14:01:26részletek
1196mineralmc.huRácz Mihály Zsolt2014-11-21 14:01:14részletek
1197miniapro.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
1198minifigures.huX-Software Kft.2014-11-21 14:01:26részletek
1199minimini.huPriger Inez2014-11-24 14:01:26részletek
1200miniszendvics.huAnonymouse Domains s.r.o.2014-11-24 14:01:25részletek
1201minosegiepites.huBertoja-Berend András2014-11-20 19:01:15részletek
1202miskolciredonyos.huJakab Szilveszter2014-11-24 14:01:27részletek
1203misterspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1204mistyx.huCziráki Vilmos2014-11-21 19:01:17részletek
1205miswak.huWebsupport s.r.o.2014-11-19 19:01:19részletek
1206mlmhivatas.huZseli Csaba2014-11-20 19:01:05részletek
1207mmsklub.huKrix Zoltán2014-11-19 19:01:13részletek
1208mobilkutyu.huPC Webáruház Kft. 2014-11-18 14:01:22részletek
1209mobilsign.huMuhari Gábor2014-11-19 14:01:17részletek
1210mobsz.huIntegrasco Kft.2014-11-21 14:01:07részletek
1211modellking.huSzilágyi János2014-11-19 14:01:20részletek
1212moderndogfurniture.huVágner Adrienn2014-11-18 14:01:13részletek
1213modernkaputelefon.huRHI Trading Kereskedelmi Kft.2014-11-18 23:01:05részletek
1214modernkonyveles.huAnger Tamás2014-11-21 14:01:28részletek
1215modernkutyabutor.huVágner Adrienn2014-11-18 14:01:10részletek
1216mogyorodiautosiskola.huHegedűs Vazul2014-11-19 14:01:16részletek
1217moire.huFinalArt Studio Kft.2014-11-19 14:01:12részletek
1218mojovibez.huFriendly Creative Agency Kft2014-11-19 23:01:02részletek
1219mokajenne.huAzonnal Kft.2014-11-17 19:01:21részletek
1220molnarmercy.huMolnár Ferenc2014-11-20 19:01:02részletek
1221moloetterem.huEuroDNS S.A.2014-11-17 14:01:22részletek
1222moltatech.huMOLTA-TECH Bt.2014-11-19 19:01:02részletek
1223momentsfilm.huKeszei Balázs2014-11-21 14:01:07részletek
1224mondoverde.huMondo Verde Casa & Giardino S.r.l.2014-11-21 23:01:04részletek
1225moneypay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
1226monimi.huSkodákné Krizsán Mónika2014-11-18 23:01:11részletek
1227monomuhely.huFinta Ferenc2014-11-21 19:01:06részletek
1228monostorikaposzta.huChrien Károly2014-11-19 14:01:03részletek
1229monstertrucks.huParamount Pictures International2014-11-19 23:01:11részletek
1230morelhifi.huPapp Zsolt2014-11-18 14:01:05részletek
1231mortofferoforras.huMortoff Kft.2014-11-21 19:01:14részletek
1232motiválódok.huGyeszát Zsolt2014-11-17 14:01:19részletek
1233motorosboltroadrider.huRoad Rider Kft2014-11-21 14:01:20részletek
1234movie-1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1235movie-one.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1236movie1.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1237moviecool.huEuroCable Magyarorszag Kft.2014-11-16 19:01:04részletek
1238movieone.huEuroCable Magyarorszag Kft.2014-11-16 19:01:03részletek
1239moziegy.huEuroCable Magyarorszag Kft.2014-11-16 19:01:05részletek
1240mozivan.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1241mpnl.huDeák András2014-11-24 14:01:12részletek
1242mrbitcoin.huEuroCable Magyarorszag Kft.2014-11-16 19:01:02részletek
1243mrspex.huEuroDNS S.A.2014-11-17 14:01:22részletek
1244mstyle.huSzabóné Molnár Mónika Éva2014-11-19 19:01:17részletek
1245mudi-suli.huBalázs Zsófia2014-11-17 14:01:05részletek
1246mueller-licht.huSysco-Lux Kft.2014-11-17 14:01:05részletek
1247muhely-titok.huFövenyi Györgyi2014-11-20 19:01:04részletek
1248mukoromzsele.huGombos Alex2014-11-19 19:01:18részletek
1249mulatosmiki.huHuncsik Ádám2014-11-18 19:01:02részletek
1250muller-licht.huSysco-Lux Kft.2014-11-17 14:01:06részletek
1251munkajogszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1252munkaruhamester.huHorváth Arszlán2014-11-19 14:01:16részletek
1253munkaruhanet.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1254munkavedelembiztonsag.huSeres Gyorgy2014-11-17 19:01:17részletek
1255munkavedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1256munzpeter.huMünz Péter2014-11-21 19:01:13részletek
1257museumhotel.huNext Kft.2014-11-17 19:01:07részletek
1258mvakolat.huMihucz Miklós e.v.2014-11-17 19:01:05részletek
1259mvhshop.hu True Trade Kft. 2014-11-20 14:01:02részletek
1260mvlvt.huSzatmári Szandra2014-11-20 14:01:12részletek
1261mxmphoto.huLovas Gábor2014-11-18 14:01:12részletek
1262mylan.co.huEuromarknet Kft. (Registrar)2014-11-18 14:01:02részletek
1263myrun.huWalter Ulrik2014-11-17 14:01:16részletek
1264mysticmoment.huSzabó Ákos2014-11-17 14:01:14részletek
1265mysticprod.huMystic Production Kft2014-11-17 14:01:06részletek
1266mythosetterem.huDP Consultingroup KFT2014-11-19 23:01:04részletek
1267n-plan.huWebsupport s.r.o.2014-11-24 14:01:02részletek
1268nagy-ep.huNagy Gábor2014-11-17 14:01:22részletek
1269nagy-szulejman.huTrivium Kiadó Kft.2014-11-20 14:01:13részletek
1270nagycsaladosok-kondoros.huMegaweb kft2014-11-20 19:01:18részletek
1271nagynyomas.hututto naturale kft2014-11-24 14:01:11részletek
1272nagyszulejman.huTrivium Kiadó Kft.2014-11-20 14:01:05részletek
1273nagyt0mi.huNagy Tamás2014-11-18 23:01:14részletek
1274nagytomi.huNagy Tamás2014-11-18 23:01:02részletek
1275nahungary.huTóth Gábor2014-11-17 14:01:02részletek
1276nanobikini.huPohl Veronika2014-11-20 19:01:07részletek
1277napellenzocentrum-gyor.huNapellenző Centrum Árnyékolástechnikai Kft. 2014-11-18 23:01:17részletek
1278napi-tender.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
1279napifrissites.hu Taktikon Kft.2014-11-17 14:01:16részletek
1280napikaja.huKánya Loránd2014-11-20 14:01:03részletek
1281napiluxus.huFlick Zsuzsanna2014-11-21 14:01:17részletek
1282napitender.huCserjési András egyéni vállalkozó2014-11-18 23:01:09részletek
1283napraforgo-kineziologia.huPRST-Invest Kft.2014-11-17 14:01:21részletek
1284napviragszappan.huConwell Kft.2014-11-20 14:01:13részletek
1285nasker.huINFO-FUNDA Betéti Társaság2014-11-20 14:01:07részletek
1286naszalymento.huViola Albert2014-11-20 19:01:03részletek
1287naszindito.huHatékony Konzultáns Kft.2014-11-20 14:01:11részletek
1288nativaszappan.huSchall Tamás2014-11-18 14:01:07részletek
1289naturdr.huVáradi Aranka2014-11-20 14:01:13részletek
1290navi-there.huVilágom Közepén Kft.2014-11-17 14:01:12részletek
1291navithere.huVilágom Közepén Kft.2014-11-17 14:01:14részletek
1292navmester.huDr. Dózsa István2014-11-24 14:01:17részletek
1293ncsk.huMegaweb kft2014-11-21 14:01:27részletek
1294neast.huIDEA BOX Kft2014-11-21 19:01:16részletek
1295nemalicit.huGelencsér Judit2014-11-18 14:01:14részletek
1296nemesfoto.huNemes Zoltán2014-11-19 14:01:07részletek
1297nemesvid.huNemesvid Község Önkormányzata2014-11-22 23:01:01részletek
1298nemetautodiszkont.huNémet Autódiszkont Kft.2014-11-17 14:01:18részletek
1299nemetiskola.huBambuk László2014-11-17 19:01:18részletek
1300nemettanfolyam.huSzigeti Ágnes2014-11-17 14:01:22részletek
1301nemzetiborbolt.huChateau Segesdi Kft.2014-11-20 14:01:13részletek
1302nemzetidron.huDeák András2014-11-24 14:01:21részletek
1303nemzetidronszovetseg.huDeák András2014-11-24 14:01:19részletek
1304nemzetiminibus.huAM Logistic Kft. 2014-11-20 19:01:16részletek
1305nemzetiminibusz.huAM Logistic Kft. 2014-11-20 19:01:16részletek
1306neocasa.huHalla Krisztina2014-11-18 23:01:11részletek
1307neocast.huKis Mátyás2014-11-21 14:01:26részletek
1308neoworks.huBosnyák Péter2014-11-19 14:01:14részletek
1309nesteoil.huNESTE OIL OYJ2014-11-21 19:01:08részletek
1310neszmelyipalinka.huDomján Kft.2014-11-21 14:01:20részletek
1311netexpresszhirdetes.huNGKE Kft.2014-11-24 14:01:15részletek
1312nethazmester.huAradi László2014-11-20 19:01:05részletek
1313nethirdetesek.huNGKE Kft.2014-11-24 14:01:19részletek
1314netjogforras.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:03részletek
1315netjogtanacsado.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:23részletek
1316netkandallok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:22részletek
1317netkazanok.huFÉMSAJTOLÓ Kft.2014-11-18 23:01:23részletek
1318netniko.huNetniko Kft.2014-11-20 19:01:20részletek
1319netszakács.huUnger Tamás2014-11-19 23:01:03részletek
1320netvarium.huNetvarium.hu Kft.2014-11-18 14:01:14részletek
1321networkhost.huKerékgyártó József2014-11-19 14:01:15részletek
1322nevjegykartya-belyegzo.huPrádel Zsolt2014-11-21 19:01:04részletek
1323newera.huOlcsváry Rudolf2014-11-19 14:01:04részletek
1324newfacemarketing.huNagy Gábor2014-11-18 14:01:22részletek
1325némete-egyetem.huKósz Csaba2014-11-18 14:01:23részletek
1326nfm.huSimia Alba Kft.2014-11-18 14:01:13részletek
1327ngmmotor.huNGM Motorfelújító Kft.2014-11-20 19:01:15részletek
1328nhir.huBaranczó Richárd2014-11-21 19:01:18részletek
1329nicebody.huNB Wellness Kft.2014-11-21 19:01:12részletek
1330nlksz.huWhitehall's Kft2014-11-17 19:01:18részletek
1331nobore.huNobore kft2014-11-18 23:01:07részletek
1332nod.huSimó István2014-11-24 14:01:20részletek
1333nokapalyan.huPéterfy-Novák Éva2014-11-18 19:01:04részletek
1334nophone.hueClick Apps Kft.2014-11-18 14:01:23részletek
1335nosztalgia-ajandek.huH Plusz P kereskedelmi és szolgáltató kft2014-11-21 19:01:10részletek
1336novalja.huVinko Róbert2014-11-17 19:01:17részletek
1337nsconsulting.hu Next Steps Consulting Kft.2014-11-17 14:01:09részletek
1338ntlaw.huEyegager Szolgáltató és Tanácsadó Korlátolt Felelősségű Társaság2014-11-17 14:01:17részletek
1339nubl.huNübl János 2014-11-24 14:01:24részletek
1340nuvita.huDevron-Impex Kft2014-11-19 14:01:18részletek
1341nyalás.huDiczkó Csaba2014-11-20 19:01:11részletek
1342nyákáruház.huHuszár Ádám2014-11-17 14:01:08részletek
1343nyelvtanfolyam-online.huProfi Profil Nyelvstúdió KFT2014-11-19 14:01:12részletek
1344nyeremenycenter.huVisual Media Kft.2014-11-18 23:01:08részletek
1345nyerjaranyat.huCardComp Product Kft.2014-11-24 14:01:18részletek
1346nyirvillany.huPátrovics Milán2014-11-17 19:01:18részletek
1347nyugdijgondoskodas.huMesszi-Szabó Gábor2014-11-19 19:01:15részletek
1348nyugdijhelyett.huErdős Nóra2014-11-17 14:01:24részletek
1349o-crypt.huINTEGRITY Kft.2014-11-21 14:01:24részletek
1350o3clean.huNezvál Gergely2014-11-19 14:01:17részletek
1351oatmealqueen.huGőkler András2014-11-19 14:01:03részletek
1352oazisstreaming.huOÁZIS Kkt.2014-11-18 14:01:04részletek
1353obezitologusok.huDr.Bedros J. Róbert2014-11-24 14:01:17részletek
1354obucity.huAuto Securit Zrt.2014-11-19 14:01:11részletek
1355oceanjoga.huDr. Asztalos Attila2014-11-21 14:01:21részletek
1356oceanyoga.huDr. Asztalos Attila2014-11-21 14:01:17részletek
1357ocrypt.huINTEGRITY Kft.2014-11-21 14:01:13részletek
1358ocslab.huOCS Lab Kft.2014-11-24 14:01:24részletek
1359odango.huWebsupport s.r.o.2014-11-21 14:01:22részletek
1360odavan.huBaranczó Richárd2014-11-21 19:01:18részletek
1361office2office.huSzever Sebastian2014-11-21 14:01:11részletek
1362officefitness.huNémeti Zoltán2014-11-19 14:01:15részletek
1363ofgroup.huOpen Future Group Kft.2014-11-21 14:01:02részletek
1364oftn.huOrszágos Fejlesztési Tanácsadó Nonprofit Kft.2014-11-18 14:01:02részletek
1365oharom.huKrix Zoltán2014-11-19 19:01:12részletek
1366okosinstallácio.huLeme Kft2014-11-20 19:01:21részletek
1367okoskalandwebshop.huRigóné Plezsik Rita2014-11-20 14:01:08részletek
1368okoskutyuk.huGradinops Kft.2014-11-17 14:01:22részletek
1369okosmami.huDealhouse Kft.2014-11-21 14:01:03részletek
1370okosmerleg.huPromedtron Kft.2014-11-17 19:01:14részletek
1371okosnyomda.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:01részletek
1372okosvercukormero.huPromedtron Kft.2014-11-17 19:01:14részletek
1373okosvernyomasmero.huPromedtron Kft.2014-11-17 19:01:13részletek
1374olasze-egyetem.huKósz Csaba2014-11-18 14:01:08részletek
1375olcsodivatoscipo.huHáry Anikó2014-11-21 14:01:03részletek
1376oletv.huWebenlét Kft.2014-11-20 19:01:05részletek
1377onconsult.huQUAESTOR Pénzügyi Tanácsadó Zrt.2014-11-21 19:01:20részletek
1378onehundred.huE-LEVEN 2003 Kereskedelmi és Szolgáltató Kft.2014-11-19 19:01:18részletek
1379onemanbandmusic.huMészáros Zoltán 2014-11-18 23:01:13részletek
1380onenesscoffee.hu Discovery Bliss Kft.2014-11-17 19:01:11részletek
1381online-film.huTóth János2014-11-24 14:01:22részletek
1382online-kotes.huKecskés Zsolt2014-11-17 19:01:22részletek
1383online-uzlet.huGila Ádám2014-11-17 14:01:15részletek
1384onlinefuv.huNoname Domain Kft.2014-11-24 14:01:25részletek
1385onlinelove.huProfi Profil Nyelvstúdió KFT2014-11-21 14:01:12részletek
1386onlinemarketingtervezes.huInternet Strategy International Kft.2014-11-17 19:01:02részletek
1387onlinemarketingugynokseg.huMolnár Dániel Ders2014-11-19 19:01:15részletek
1388onlinemarketingügynökség.huMolnár Dániel Ders2014-11-19 19:01:01részletek
1389onlinemegyeitelefonkonyv.huWebenlét Kft.2014-11-20 14:01:05részletek
1390onlinepizzeria.huGergely László Andras2014-11-20 19:01:21részletek
1391onniconsulting.huVértes Róbert2014-11-16 19:01:03részletek
1392opelbarta.huAutó Bartex Kft.2014-11-17 14:01:18részletek
1393openfuture.huOpen Future Group Kft.2014-11-21 14:01:02részletek
1394optikvarium.huBamaco Optik Kft.2014-11-21 14:01:21részletek
1395optimumhotels.huKlemm Balázs Lajos2014-11-16 19:01:01részletek
1396opuseteducatio.huHorváth Cz. János2014-11-20 19:01:22részletek
1397orange-oil.huDom West Kft2014-11-18 23:01:04részletek
1398orangeoil.huDom West Kft2014-11-18 23:01:05részletek
1399oriasmaci.huWisol Kft.2014-11-21 14:01:26részletek
1400oriasmuffin.huJónás Milán2014-11-19 19:01:03részletek
1401oriassuti.huJónás Milán2014-11-19 23:01:07részletek
1402ormeny-katolikus.huKövér István2014-11-21 14:01:23részletek
1403oror.huVízy András Miklós2014-11-21 19:01:14részletek
1404orosze-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
1405orszagoskepzesijegyzek.huEDUCERT Képzésmódszertani és Minőséghitelesítési Kft.2014-11-24 14:01:18részletek
1406orszagospenztargepszovetseg.huNazza Software Kft.2014-11-17 14:01:13részletek
1407orvospenztargepek.huNazza Software Kft.2014-11-17 14:01:19részletek
1408osztalypenztar.huUnidomain Kft.2014-11-18 19:01:04részletek
1409oszter.huMidani Nizar2014-11-20 14:01:14részletek
1410otletvarazs.huFidus Company Bt2014-11-20 19:01:06részletek
1411ottbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1412otthoniuzlete.huUngár Ferenc2014-11-18 19:01:06részletek
1413otyliastyle.huSőrés Ottilia2014-11-19 19:01:21részletek
1414ovisjelgyar.huMolnár Balázs2014-11-24 14:01:03részletek
1415owhungary.huSk-Bau Kft.2014-11-17 14:01:15részletek
1416ozdfoto.huJancsurák Gábor2014-11-18 14:01:29részletek
1417ozoneclean.huNezvál Gergely2014-11-19 14:01:14részletek
1418p3t1.huVarga Péter2014-11-17 14:01:05részletek
1419packersvideotar.huSchmidtka László2014-11-17 19:01:03részletek
1420packplus.huDS Smith Packaging Hungary Kft2014-11-19 19:01:03részletek
1421pajerovalbamakoba.huDr. Szabó Kristóf2014-11-20 19:01:10részletek
1422palatina-felvásárlás.huCardComp Product Kft.2014-11-24 14:01:22részletek
1423paleopontpecs.huPabelo Kft.2014-11-17 19:01:13részletek
1424pamutharisnya.huÖko-PC Kft.2014-11-21 19:01:15részletek
1425pandajatek.huRévész László2014-11-20 14:01:11részletek
1426panelprogram2015.huDobonyi Valentina2014-11-18 14:01:27részletek
1427panniesbence.huSimonváros Katalin2014-11-21 23:01:03részletek
1428papinothpekseg.huPapinoth Sütőipari Kft2014-11-18 14:01:04részletek
1429papirekszer.huMéri Judit2014-11-18 14:01:22részletek
1430pappanikomira.huPapp Anikó Míra2014-11-22 23:01:01részletek
1431paradoxunion.huParadox Union Kft.2014-11-21 14:01:04részletek
1432parlagisasalapitvany.hu Parlagi Sas Alapítvány2014-11-19 14:01:09részletek
1433parokaplaza.huWeb-Zseb Kereskedelmi és Szolgáltató Bt.2014-11-17 14:01:19részletek
1434partytrendek.huSWA Szervíz Kft2014-11-17 19:01:14részletek
1435pasreklam.huHorváth Attila 2014-11-21 19:01:15részletek
1436passionerie.huGenius Marketing Management Kft2014-11-17 23:01:02részletek
1437patavafa.huVas János 2014-11-19 14:01:12részletek
1438patrol24.huPATROL24 Technologies Korlátolt Felelősségű Társaság 2014-11-21 14:01:06részletek
1439payaccounts.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1440paycoin.huGanyecz Gábor2014-11-20 14:01:07részletek
1441paycredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:10részletek
1442payin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
1443payout.huEuroCable Magyarorszag Kft.2014-11-18 23:01:17részletek
1444paytransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1445pcstream.huDeák András László2014-11-21 19:01:02részletek
1446pcszervizszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
1447peabomedia.huWebsupport s.r.o.2014-11-21 14:01:03részletek
1448pecsert.huÖsszefogás Pécsért Egyesület2014-11-17 19:01:03részletek
1449pecsiingatlan.huRackhost Kft. (Registrar)2014-11-18 14:01:10részletek
1450pemco.huSCT Hungary Kft2014-11-19 19:01:16részletek
1451pemcoolaj.huSCT Hungary Kft2014-11-19 19:01:16részletek
1452pendienda.huÖKO-Technika Bt.2014-11-18 23:01:13részletek
1453pepemano.huBaracsi István2014-11-17 14:01:11részletek
1454pere-design.huPerényi Dániel2014-11-19 19:01:20részletek
1455perfectmind.huDemény Zsolt2014-11-17 19:01:04részletek
1456pesti-cola.huWalking Image Kft.2014-11-20 19:01:13részletek
1457pesticola.huWalking Image Kft.2014-11-20 19:01:03részletek
1458peterszalay.huSzalay Péter2014-11-18 23:01:13részletek
1459petmagic.huDigital Inspiration Online Kft.2014-11-20 14:01:15részletek
1460petofiudszov.hu"Petőfi" Üdülőszövetkezet2014-11-19 14:01:03részletek
1461petrénypincészet.huSzabó Richárd András2014-11-18 14:01:25részletek
1462petzingercukraszat.huPetzinger Judit 2014-11-20 14:01:02részletek
1463pgpro.huWebsupport s.r.o.2014-11-16 19:01:07részletek
1464pgprof.huWebsupport s.r.o.2014-11-16 19:01:04részletek
1465phantomsmoke.huJoker Busz Travel Kft.2014-11-19 19:01:12részletek
1466pharmekal.huWell-Form Kft.2014-11-20 19:01:06részletek
1467philae.huPohl Veronika2014-11-17 19:01:08részletek
1468phodography.huNiedermüller Tamás Bálint2014-11-24 14:01:09részletek
1469pic-studio.huGyőrfi András2014-11-20 19:01:09részletek
1470pillaeskorom.huGépDepo.hu Kisgép és Szerszám Szakkereskedés Kft.2014-11-20 19:01:06részletek
1471pillanatom.huSzabó Gábor2014-11-18 14:01:03részletek
1472pillangocsoport.huAlacs Edina2014-11-19 14:01:06részletek
1473pillemano.huErdész-Márkus Anita2014-11-19 14:01:10részletek
1474pilotanelkuli.huDeák András2014-11-24 14:01:14részletek
1475pilotanelkulilegijarmu.huDeák András2014-11-24 14:01:12részletek
1476pinkrock.huPink Rock Investor Relations Kft.2014-11-19 19:01:16részletek
1477pirotlaszlo.huPirót Ádám2014-11-21 14:01:30részletek
1478pizza112.huTóth Rudolf2014-11-21 14:01:04részletek
1479pizzasprintmiskolc.huBrógli Máté2014-11-17 14:01:08részletek
1480plac.huM&D Holding Kft2014-11-18 23:01:23részletek
1481plancal.huTGA Consult Épületgépészeti Fövállalkozó és Mérnökiroda Kft.2014-11-20 19:01:04részletek
1482plastidip-shop.huFlyR Reklámműhely kft2014-11-20 19:01:11részletek
1483plastinvest.huKurán Antal2014-11-18 14:01:20részletek
1484plazainformacio.huInternet Strategy International Kft.2014-11-17 19:01:01részletek
1485plusmagma.huCogitatus Kft.2014-11-24 14:01:07részletek
1486pnl.huDeák András2014-11-24 14:01:12részletek
1487pnr.huDeák András2014-11-24 14:01:18részletek
1488pofonfutar.huV8 IT & MEDIA Kft.2014-11-21 14:01:14részletek
1489pointsofyou.huD-LAB Consulting Kft.2014-11-20 14:01:11részletek
1490polelites.huSzabó Szilárd2014-11-21 23:01:03részletek
1491pomiversum.huKozalik Attila2014-11-20 19:01:02részletek
1492ponstrik.huPONSTRIK Korlátolt Felelősségű Társaság2014-11-20 14:01:10részletek
1493pontapps.huPont Systems Zrt.2014-11-20 19:01:16részletek
1494pontefilm.huQUAESTOR Pénzügyi Tanácsadó Zrt.2014-11-21 19:01:12részletek
1495poo-pourri.huSeducanto s.r.o.2014-11-19 19:01:06részletek
1496pornósztárok.huDiczkó Csaba2014-11-21 14:01:19részletek
1497pos-digital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
1498posdigital.huPOS Media Global Services, s.r.o.2014-11-19 19:01:12részletek
1499pospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:16részletek
1500postpay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1501potgazdi.huOlma Gabriella2014-11-18 23:01:04részletek
1502pqrst.huRadnai Balázs2014-11-24 14:01:24részletek
1503prc-product.huKovács András2014-11-17 14:01:24részletek
1504premiumbrikett.huS and P Trucks Kft2014-11-20 14:01:06részletek
1505premiumchocolate.huGEO-13 KFT.2014-11-21 14:01:22részletek
1506premiumtanacsadas.huTörkő Zsolt2014-11-21 14:01:06részletek
1507prenome.huCene Judit2014-11-19 19:01:17részletek
1508primaweb.huUlicska Tamás2014-11-21 19:01:10részletek
1509primusaqua.huBonaventura Gold Kft2014-11-17 14:01:18részletek
1510printnet.huPrintnet Kft. 2014-11-21 19:01:20részletek
1511printsqr.huPrint sqr Kereskedelmi és Szolgáltató Korlátolt Felelősségű Társaság2014-11-24 14:01:17részletek
1512prixa.huPausch Rita2014-11-19 19:01:20részletek
1513probaljki.huPannon-Servus Kft.2014-11-18 23:01:24részletek
1514probiotikum-blog.huVitaminKosár Kft.2014-11-20 19:01:21részletek
1515probiotikumblog.huVitaminKosár Kft.2014-11-20 19:01:17részletek
1516profitisztitas.huUnidomain Kft.2014-11-17 19:01:05részletek
1517profitnavigator.huDiamond Books Kft.2014-11-17 19:01:03részletek
1518progeo.huRépás Zoltán2014-11-21 19:01:07részletek
1519project2501.huKlenóczki Norbert2014-11-18 23:01:15részletek
1520projektangyal.huEUROPROJEKT EGER Kft.2014-11-20 14:01:06részletek
1521proksasef.huBrankovics Gábor 2014-11-21 19:01:08részletek
1522promedica.huB-ALL-MED Bt.2014-11-19 23:01:06részletek
1523promedica24.huDr. Gajdics Gábor2014-11-21 14:01:03részletek
1524protokoll-beszerzes.huMajor Roland2014-11-17 23:01:01részletek
1525providss.huProvid Special Service Kft.2014-11-18 14:01:02részletek
1526proxyszerver.hueForce Informatikai és Kereskedelmi Kft.2014-11-19 19:01:21részletek
1527pszbacs.huKrix Zoltán2014-11-20 14:01:12részletek
1528ptewebprint.huBalla Dávid2014-11-18 23:01:12részletek
1529pulsarium.huKollár István2014-11-18 23:01:03részletek
1530pure.huUnidomain Kft.2014-11-21 19:01:05részletek
1531pureleverage.huWebsupport s.r.o.2014-11-20 19:01:19részletek
1532puskelzsolt.huPuskel Zsolt2014-11-21 14:01:10részletek
1533pvctech.huPVC-TECH Ipari, Kereskedelmi és Szolgáltató Kft.2014-11-21 19:01:06részletek
1534qualitytrading.huQuality Trading Bt.2014-11-18 14:01:28részletek
1535quick24.huUgocean Janos Peter Persoana Fizica Autorizata2014-11-21 19:01:13részletek
1536radio1gyor.huSzakos Péter2014-11-18 19:01:08részletek
1537radioaktivpecs.huKrix Zoltán2014-11-19 19:01:22részletek
1538raklaposkonyv.huvagabund kiadó ec.2014-11-24 14:01:19részletek
1539raklaposkonyvek.huvagabund kiadó ec.2014-11-24 14:01:26részletek
1540rakodogepberles.huSzatmári Róbert2014-11-21 14:01:22részletek
1541raktar-guru.huPethő Eszer2014-11-20 14:01:08részletek
1542raktaroid.huPickermann Adél2014-11-19 14:01:14részletek
1543randivideo.huNoname Domain Kft.2014-11-18 23:01:06részletek
1544raspartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1545ravenololaj.huSCT Hungary Kft2014-11-19 19:01:17részletek
1546rbpartners.huR&B Partners Könyvelőiroda és Tanácsadó Betéti Társaság2014-11-24 14:01:24részletek
1547reality-property.co.huReality-property Kft2014-11-21 14:01:29részletek
1548rean.huAnger Tamás2014-11-21 14:01:28részletek
1549redony-satoraljaujhely.huRutai Sándor2014-11-21 14:01:13részletek
1550redony-szerencs.huRutai Sándor2014-11-21 14:01:12részletek
1551redonyerd.huRutai Sándor2014-11-17 14:01:06részletek
1552redoxcsoport.huEszik Marianna2014-11-18 14:01:27részletek
1553reduline-36.huW-BUSINESS S. R. O.2014-11-21 19:01:12részletek
1554refiper.huCserháti Ferenc2014-11-19 14:01:11részletek
1555regenexa.huDr. Bábel Béla Tamás2014-11-17 14:01:03részletek
1556regesorozo.huOpenLocal Kft.2014-11-24 14:01:21részletek
1557reggaetonsuli.huSzádvári Zoltán2014-11-24 14:01:19részletek
1558regisegekpiaca.huKérai Gusztáv2014-11-17 19:01:06részletek
1559regisztracios-ado.huKovács Péter2014-11-20 19:01:22részletek
1560regkft.huReal Estate & Garden Solutions Kft.2014-11-20 19:01:22részletek
1561rehatechnika.huReha-Technika Kft.2014-11-20 19:01:18részletek
1562reli.huHettich Zsolt2014-11-19 23:01:11részletek
1563rendezvenyguru.huMillennium International Kft.2014-11-17 19:01:03részletek
1564rendszergazdaszolnok.huADACSA Kft.2014-11-18 14:01:09részletek
1565rendy.huRendes Gábor E.V.2014-11-20 14:01:05részletek
1566reneszanszajandek.huReneszánsz Panoptikum Kft.2014-11-19 14:01:16részletek
1567rentallcar.huPálvölgyi Gábor2014-11-17 19:01:18részletek
1568repulogepemlekpark.huKrix Zoltán2014-11-19 19:01:13részletek
1569repulospajz.huFarkas Andrea2014-11-19 14:01:16részletek
1570restauratorart.huGyöpös Viktória2014-11-18 23:01:23részletek
1571restopanorama.huBornemissza Sándor2014-11-24 14:01:05részletek
1572reszletre.huBártfai Balázs2014-11-18 14:01:02részletek
1573retailhungary.huMajor Krisztina e.v.2014-11-19 19:01:12részletek
1574revelar.huNaturemed Kft2014-11-17 14:01:10részletek
1575revkft.huRÉV Kft.2014-11-19 14:01:16részletek
1576rezsinullazo.huRubi Consulting Kft.2014-11-21 19:01:12részletek
1577régiségekpiaca.huKérai Gusztáv2014-11-18 14:01:22részletek
1578rfb.huUnidomain Kft.2014-11-17 14:01:01részletek
1579ricamente.huRicamente Kft.2014-11-18 14:01:09részletek
1580rina.huCarina Novum Kft.2014-11-21 14:01:18részletek
1581ringieraxelspringerpartner.huRingier Axel Springer Magyarország Kft.2014-11-17 19:01:10részletek
1582rinity.huSzabó Károly2014-11-18 14:01:29részletek
1583ritanti.huTóthné Herner Rita2014-11-18 14:01:16részletek
1584ritauzlethaz.huIMMOWIT Kft.2014-11-19 14:01:14részletek
1585rkelenyiangelika.huPublish and More Kft.2014-11-21 19:01:09részletek
1586roachy.huRozsnyai Zsolt2014-11-18 14:01:18részletek
1587roadruner.huAlcuin Schola Kft.2014-11-17 14:01:09részletek
1588roboroom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1589roboshop.huRobotguru Kereskedőház Kft.2014-11-17 19:01:07részletek
1590robotest.huRobotguru Kereskedőház Kft.2014-11-17 19:01:09részletek
1591robotv.huRobotguru Kereskedőház Kft.2014-11-17 19:01:06részletek
1592robozoom.huRobotguru Kereskedőház Kft.2014-11-17 19:01:08részletek
1593rockmunkavedelem.huMolnár és Társa Kft.2014-11-17 14:01:22részletek
1594rockpub.huDoor2World Bt.2014-11-18 23:01:12részletek
1595rockpubcafe.huDoor2World Bt.2014-11-18 23:01:12részletek
1596rocksafety.huMolnár és Társa Kft.2014-11-17 14:01:21részletek
1597roku.huEuroCable Magyarorszag Kft.2014-11-20 19:01:16részletek
1598rolandkis.huKis Roland2014-11-20 19:01:11részletek
1599romaipartihirek.huRSE Római Part Nonprofit Kft.2014-11-20 19:01:04részletek
1600romanticgardrob.huSiposné Geschitz Annamária e.v.2014-11-20 14:01:16részletek
1601romerautosules.huBaba-Ker Kft2014-11-17 14:01:04részletek
1602roncs-licit.huSzugyiczki András2014-11-20 14:01:03részletek
1603roncsautoaukcio.huSzugyiczki András2014-11-20 14:01:03részletek
1604rovarcsapdaaruhaz.huBLA-TOX Kft2014-11-21 14:01:28részletek
1605rovarcsapdashop.huBLA-TOX Kft2014-11-21 14:01:03részletek
1606ruha-webshop-info.huMódium Divatház Kft.2014-11-21 19:01:03részletek
1607ruhaklinika.huMens Wear Kft.2014-11-18 19:01:05részletek
1608safelaserinfo.huKálmán Viktor Tamás2014-11-24 14:01:12részletek
1609sajticsaba.huSajti Csaba2014-11-17 19:01:17részletek
1610sajtosport.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1611salatagyar-eletmod-shop.huFITTBÁZIS Életmód Bt.2014-11-19 14:01:21részletek
1612saleandbuy.huGEO-13 KFT.2014-11-21 14:01:21részletek
1613salsasuli.huSzádvári Zoltán2014-11-24 14:01:20részletek
1614samsonline.huVarga János2014-11-20 19:01:12részletek
1615saniflex.huGecsey Mihály2014-11-21 14:01:14részletek
1616sanpaolo.huKoffein-Futár Kft.2014-11-19 23:01:06részletek
1617sarahazavendeghaz.huHerczeg Krisztina2014-11-19 19:01:19részletek
1618saturdays.huKovács Balázs2014-11-17 14:01:14részletek
1619schonecker.huBARBER ART KFT2014-11-21 19:01:09részletek
1620schwarczattila.huDr. Schwarcz Attila2014-11-19 23:01:12részletek
1621scoliosisterapia.huHolcsa Judit2014-11-18 14:01:06részletek
1622scop.huCOP Rendszertechnika Kft.2014-11-19 19:01:22részletek
1623seeoo-cvikker.huGravitas B.V.Á. Kft.2014-11-21 23:01:03részletek
1624selfibot.huVeres Tamás2014-11-18 14:01:17részletek
1625selfiepalca.huVeres Tamás2014-11-18 14:01:18részletek
1626selfipalca.huVeres Tamás2014-11-18 14:01:23részletek
1627sensationstyling.huSensation Styling Kft2014-11-19 14:01:13részletek
1628sexdating.huKrix Zoltán2014-11-19 19:01:07részletek
1629sextopbox.huEuroCable Magyarorszag Kft.2014-11-20 19:01:18részletek
1630shenzeneurope.huPusztai József Tamás2014-11-21 14:01:21részletek
1631shoppingvin.huDolphinet Kft.2014-11-17 14:01:18részletek
1632shoppingwin.huDolphinet Kft.2014-11-17 14:01:11részletek
1633signalshop.huFerunio 95 Kft.2014-11-18 14:01:30részletek
1634sikerdijas-keresooptimalizalas.huStarSoft International Kft.2014-11-24 14:01:28részletek
1635silentmusic.huCyclick Kft.2014-11-19 23:01:07részletek
1636sillyfaceoff.huEuromarknet Kft. (Registrar)2014-11-21 14:01:29részletek
1637silux.huWebenlét Kft.2014-11-16 19:01:03részletek
1638simonhantai.huARCHIVES SIMON HANTAI2014-11-20 14:01:13részletek
1639simplexpalyazat.huHorváth Ádám2014-11-21 14:01:06részletek
1640sipostibor.huSipos Tibor2014-11-19 19:01:10részletek
1641sipper.huSipper Transport Kft. 2014-11-18 14:01:24részletek
1642sivantos.huSiemens Audiologische Technik GmbH2014-11-24 14:01:05részletek
1643sj4000sportkamera.huElectropoint Kft.2014-11-18 23:01:11részletek
1644skydoorshop.huHorváth Roland László E.V.2014-11-17 14:01:24részletek
1645skyflytravel.huZ+T Bt.2014-11-18 14:01:04részletek
1646skypeprofesszor.huSztolár Miklós2014-11-17 19:01:20részletek
1647sleader.huRózsa Péter2014-11-19 14:01:03részletek
1648sleepingbeauty.huRéti Enikő2014-11-21 19:01:16részletek
1649smartinstall.huSmart Install Kft.2014-11-19 14:01:13részletek
1650smartpay.huEuroCable Magyarorszag Kft.2014-11-19 19:01:18részletek
1651smartrailwaysolution.huSmart Railway Solution Kft. 2014-11-24 14:01:22részletek
1652smtp-szerver.huIT-Nav Hungary Kft2014-11-21 23:01:03részletek
1653socialmarket.huImex Global Kft.2014-11-21 19:01:12részletek
1654sodrasszalon.hu2GP Kft2014-11-17 19:01:06részletek
1655sofilux.huSofilux Kft.2014-11-20 19:01:11részletek
1656soft-telekom.huSoft-Dekor Kft2014-11-18 23:01:03részletek
1657softguru31.huSeres Sándor2014-11-24 14:01:03részletek
1658softskillsinit.huSzabó Csaba2014-11-21 19:01:14részletek
1659softwarecraftsmanship.huAndó Művek Korlátolt Felelősségű Társaság2014-11-18 14:01:06részletek
1660somatodrol.huJPT Investment Partners Limited2014-11-21 19:01:02részletek
1661somlomuvek.huZs. Somló Krisztián2014-11-21 19:01:03részletek
1662sopronibolcsodek.huBökönyi Norbert EV.2014-11-20 19:01:13részletek
1663soproniingatlan.huKrix Zoltán2014-11-19 19:01:11részletek
1664sorkatonavoltam.huMihályi Produkció KFT.2014-11-21 14:01:25részletek
1665sorozatvago.huIwood Kft.2014-11-20 19:01:17részletek
1666sorsfutar.huRatkai Dávid2014-11-19 14:01:09részletek
1667soszoba-sopron.huKerékgyártó Kereskedelmi és Szolg. Bt.2014-11-18 14:01:08részletek
1668spanyole-egyetem.huKósz Csaba2014-11-18 14:01:19részletek
1669specops.huSpecops Hungary Kft.2014-11-19 14:01:09részletek
1670speed-fittness.huVér József2014-11-19 19:01:05részletek
1671speedtruckservice.huSpeed Truck Service Kft.2014-11-18 14:01:30részletek
1672spineartgyogytorna.huHolcsa Judit2014-11-18 14:01:09részletek
1673spinnerszek.huSpinner Kerekesszék Gyártó Kft.2014-11-17 14:01:07részletek
1674spiphone.huSPInet Magyarország Kft.2014-11-21 14:01:05részletek
1675spiritfitness.huSisák Zoltán2014-11-19 19:01:20részletek
1676sportmotivacio.huNyomárkay András2014-11-19 23:01:10részletek
1677sportoutletshop.huKatona Dániel2014-11-19 19:01:21részletek
1678sportpalace.huZsorja Sport Kft. 2014-11-21 14:01:19részletek
1679srff.huPortoLogic Kft2014-11-17 14:01:10részletek
1680srichinmoykonyvek.huMadal Bal Kft2014-11-21 19:01:09részletek
1681sslland.hu23VNET Kft. (Registrar)2014-11-21 19:01:05részletek
1682stadionguide.huElender 2000 Kft2014-11-18 14:01:17részletek
1683stadionkalauz.huElender 2000 Kft2014-11-18 14:01:17részletek
1684startlapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1685startupdomain.huMonitor Média Kft.2014-11-20 14:01:06részletek
1686startupkft.huStart Up Kft.2014-11-20 19:01:11részletek
1687startupp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1688startupsuli.huLauritzen Instore Kft.2014-11-21 14:01:14részletek
1689statlogics.huStatlogics Szoftverfejlesztő Zrt.2014-11-24 14:01:11részletek
1690stilusesdivat.huRiczkó István2014-11-17 14:01:24részletek
1691stoneenergykft.huStone Energy Kft2014-11-17 14:01:05részletek
1692styleboutique.huBalla Tibor2014-11-18 14:01:26részletek
1693sungardenszalon.huNeusch Csaba2014-11-18 23:01:14részletek
1694sungardenszolarium.huNeusch Csaba2014-11-19 19:01:14részletek
1695sunrisebeachhungary.huSzabó Tibor2014-11-21 23:01:04részletek
1696sunrisehosting.huBuzás Péter2014-11-16 19:01:05részletek
1697sunstrip.huTürk Sára2014-11-21 19:01:07részletek
1698superoutlet.huKészlet-Fészek Bt.2014-11-21 19:01:19részletek
1699superworld.hu Dora-Land Kft.2014-11-17 14:01:15részletek
1700sushibar.huPADOS PIPI Kereskedelmi Betéti Társaság2014-11-21 19:01:11részletek
1701sutimegen.huWebsupport s.r.o.2014-11-17 19:01:22részletek
1702sutizz.huSomlyódy-Gerő Eszter2014-11-16 19:01:06részletek
1703suznvilaga.huHujber Zsuzsanna2014-11-21 19:01:12részletek
1704swaszervizkft.huSWA Szervíz Kft2014-11-17 19:01:15részletek
1705swconsulting.huST devices Bt.2014-11-17 19:01:12részletek
1706sweethairwebshop.huHorváth Bíborka2014-11-17 19:01:08részletek
1707swine.huRadnai László2014-11-18 23:01:11részletek
1708sxi.sport.huPreisinger Gábor2014-11-16 19:01:07részletek
1709sylviapartner.huBardovics Bt2014-11-19 23:01:07részletek
1710symbolonintezet.huQS 2000 Bt.2014-11-17 19:01:18részletek
1711syncovery.huVE-Matéria Kft.2014-11-17 19:01:06részletek
1712szablyavivas.huBalogh Attila2014-11-19 14:01:15részletek
1713szaboestsa.huGyapiNet Bt.2014-11-18 23:01:02részletek
1714szabofogaszat.huERSATZ Fogászati Bt.2014-11-24 14:01:06részletek
1715szaboking.huSzabó Tibor2014-11-19 23:01:07részletek
1716szakalyjanos.huSzakály János2014-11-17 19:01:10részletek
1717szakikereso.huFilep Józsefné2014-11-17 14:01:02részletek
1718szakmaicegbazis.huMiszlai-Holdosi Henrietta2014-11-18 14:01:11részletek
1719szakmattanulok.huJózanné Sipos Etelka2014-11-18 14:01:21részletek
1720szallodaknapja.huEuroDNS S.A.2014-11-17 14:01:17részletek
1721szameg.huVégh Máté2014-11-21 14:01:20részletek
1722szamitogep-laptopszerviz.huP-norton Kft.2014-11-17 14:01:19részletek
1723szamlazzweben.huRiskCont Bt.2014-11-24 14:01:13részletek
1724szamocahaz.huSzabó Mónika2014-11-20 19:01:16részletek
1725szamocakozpont.huSzabó Mónika2014-11-20 19:01:14részletek
1726szamocapedagogia.huSzabó Mónika2014-11-20 19:01:05részletek
1727szamvitelszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1728szanyizsolt.huSzanyi Zsolt2014-11-21 14:01:16részletek
1729szaszabutik.huPataki Szandra Mária2014-11-21 14:01:15részletek
1730szaszamotorsport.huSzabó Gábor2014-11-21 19:01:10részletek
1731szatmaroffice.huElektrix Rendszerház Kft2014-11-21 19:01:06részletek
1732szatyika.huSzathmári József2014-11-17 14:01:04részletek
1733szekesfehervarfogaszat.huHedent Fogorvosi Szolgáltató Betéti Társaság2014-11-21 19:01:21részletek
1734szelfiebot.huVeres Tamás2014-11-18 14:01:23részletek
1735szelfiepalca.huVeres Tamás2014-11-18 14:01:23részletek
1736szelfipalca.huVeres Tamás2014-11-18 14:01:23részletek
1737szemelyesatvetelipont.huManda Kft.2014-11-18 14:01:11részletek
1738szemelyiedzok.huBatyi Béla2014-11-17 19:01:20részletek
1739szemle.huBelvedere Meridionale Kft.2014-11-19 14:01:02részletek
1740szenioreletmod.huLesko Márk2014-11-19 19:01:16részletek
1741szentmiklosparkfalu.huJUKO Kft.2014-11-19 14:01:14részletek
1742szepnapok.huErdős Nóra2014-11-17 14:01:11részletek
1743szepsegnap.huMarsi László2014-11-24 14:01:08részletek
1744szerelemlakatgyar.huCzövek Róbert2014-11-21 19:01:08részletek
1745szeretetpiac.huRadnay Péter2014-11-17 14:01:03részletek
1746szerviz7.huSzűcs József2014-11-21 19:01:12részletek
1747szexshop-hungary.huKrix Zoltán2014-11-19 19:01:07részletek
1748szieglpince.huSziegl Családi Pince Kft.2014-11-21 14:01:10részletek
1749szikrasecurity.huKisari Ádám2014-11-20 19:01:14részletek
1750szingli-fesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
1751szinglifesztival.huTeleki Sámuel Utazási Iroda Kft.2014-11-19 19:01:05részletek
1752szinpadom.huHorváth Ferenc2014-11-21 19:01:19részletek
1753szip-map.hueNET Internetkutató és Tanácsadó Kft.2014-11-20 19:01:22részletek
1754sziviszovi.huIT DEPO Kft.2014-11-19 23:01:09részletek
1755színpadom.huHorváth Ferenc2014-11-21 19:01:09részletek
1756szocialisdepo.huMajoros Márta2014-11-20 19:01:10részletek
1757szocstamas.huDr. Szőcs Tamás2014-11-18 14:01:07részletek
1758szolnoketterem.huMB Vagyonkezelő Kft.2014-11-17 19:01:09részletek
1759szolnoktar.huVerseghy Ferenc Könyvtár és Közművelődési Intézmény2014-11-19 14:01:10részletek
1760szombathelyigamesz.huSzombathelyi Köznevelési GAMESZ 2014-11-21 14:01:17részletek
1761szonyegekonline.huSakina-Textile Kft2014-11-18 14:01:25részletek
1762szopás.huDiczkó Csaba2014-11-20 19:01:08részletek
1763szulejmán.huTrivium Kiadó Kft.2014-11-17 14:01:17részletek
1764szulinapra2010.huTarján Tibor2014-11-17 19:01:11részletek
1765tabletnyomda.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1766tabletpenztargep.huNazza Software Kft.2014-11-20 14:01:14részletek
1767tagikolcson.huSilicium Network Informatikai Kft.2014-11-21 14:01:24részletek
1768taichi-mindenkinek.huAnonymouse Domains s.r.o.2014-11-18 14:01:29részletek
1769takacszsolt.huTakács Zsolt EV2014-11-18 14:01:11részletek
1770talizmansport.huPapp Jánosné2014-11-17 14:01:19részletek
1771tallinder.huLPP S.A.2014-11-17 14:01:05részletek
1772tallinton.huLPP S.A.2014-11-17 14:01:05részletek
1773tamaratorna.huST Art & Web Kft.2014-11-17 14:01:23részletek
1774tapetafutar.huÁrvai Sándor2014-11-17 19:01:19részletek
1775tapetanagyker.huKutasi-Vilsitz Kft2014-11-17 19:01:16részletek
1776taplalkozastudomany.huPankotai-Nagy Nóra Lívia2014-11-17 14:01:12részletek
1777targoncaforum.huHÓD-Agroszer Kft.2014-11-18 14:01:26részletek
1778tarpahill.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
1779tarsalkodok.huPásztor László2014-11-18 23:01:10részletek
1780tarsashazepito.huBertoja-Berend András2014-11-20 19:01:03részletek
1781taskacarp.huWebsupport s.r.o.2014-11-19 23:01:11részletek
1782tavaszizene.huTatabányART Művészeti Egyesület2014-11-18 14:01:06részletek
1783taxinvestment.huTax Investment Kft.2014-11-19 23:01:03részletek
1784taxismart.huEuroCable Magyarorszag Kft.2014-11-16 19:01:06részletek
1785taylors.huTaylors Fashion Korlátolt Felelősségű Társaság2014-11-21 14:01:26részletek
1786tcg-global.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:21részletek
1787tcgglobal.huMithrandir Informatechnológiai Kft.2014-11-17 19:01:15részletek
1788teaacademy.hu Sólámpás Kft.2014-11-17 14:01:18részletek
1789teaworld.huKamala Kft.2014-11-19 14:01:04részletek
1790techcentral.huTechcentral Kft.2014-11-17 14:01:10részletek
1791technosport.huKrix Zoltán2014-11-19 19:01:02részletek
1792tecom-as.huT E C O M Analytical Systems CS spol. s r.o.2014-11-24 14:01:09részletek
1793teenbuilding.huNetkorzo Online Szolgáltató Kft2014-11-21 14:01:16részletek
1794teglasjohanna-webdesign.huTéglás Johanna2014-11-20 14:01:14részletek
1795teisfoundation.huTegyünk Együtt az Ifjúságért Alapítvány2014-11-21 14:01:19részletek
1796telefuvar.huKontroll Média Kft2014-11-24 14:01:10részletek
1797telekomwebshop.huDutel Kft. 2014-11-10 14:01:23részletek
1798telepit.huPC Tronic Kft2014-11-24 14:01:10részletek
1799teljeselmesalkotas.huBihari László2014-11-19 19:01:06részletek
1800tenderhirek.huCserjési András egyéni vállalkozó2014-11-18 23:01:08részletek
1801teneues.huAlfa-Glossza Fordítóiroda és Szolgáltató Kft. 2014-11-20 19:01:14részletek
1802terapia-gyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:07részletek
1803terapiagyoparos.huMKM Marketing Institute Kft.2014-11-20 19:01:10részletek
1804termekmatrica.huFülöp Attila2014-11-21 19:01:17részletek
1805termeloimezpiac.huMakács Zoltán2014-11-17 19:01:12részletek
1806teszi.huTESZI Szent György Központ2014-11-21 14:01:14részletek
1807tesztapp.huHortobágyi Ágoston2014-11-19 23:01:09részletek
1808tetofedes-kaposvar.huRutai Sándor2014-11-20 19:01:07részletek
1809thermoline.huTHERMO LINE Mérnöki Kft.2014-11-21 14:01:07részletek
1810thetateremtes.huNagy Enikő2014-11-21 14:01:10részletek
1811tibekacnc.huTibeka-Design Kft2014-11-19 23:01:11részletek
1812tibysoft.huMészáros Tibor2014-11-18 14:01:22részletek
1813tiensszombathely.huTakács László2014-11-17 14:01:25részletek
1814tietokone.huTietokone Kft.2014-11-19 14:01:08részletek
1815tillmanphoto.huBukovenszki Tamás2014-11-24 14:01:26részletek
1816timiesantal.huVarga Norbert2014-11-20 19:01:05részletek
1817tinipornó.huDiczkó Csaba2014-11-21 14:01:30részletek
1818tiszariver.huKrix Zoltán2014-11-19 19:01:13részletek
1819tiszatrade.huTISZA-TRADE KFT2014-11-18 14:01:28részletek
1820tisztatarsashaz.huSzabó Péter2014-11-18 14:01:28részletek
1821tizenketto.huKő Tamás2014-11-17 14:01:20részletek
1822tnno.huAdminSYS Kft.2014-11-18 14:01:03részletek
1823tocsport.huPartner Kft.2014-11-21 14:01:09részletek
1824todayslook.huHostnet bv2014-11-18 14:01:27részletek
1825toltoanyag.huDunaCom Plus Kft.2014-11-19 19:01:02részletek
1826tomascooksport.huPartner Kft.2014-11-21 14:01:09részletek
1827tombsajt.huFoodnet Kft.2014-11-21 19:01:17részletek
1828tomitextil.huMaszlag Tamás2014-11-17 19:01:20részletek
1829tonaexpert.huSARATOGA HUNGARY KFT.2014-11-24 14:01:28részletek
1830top10radio.huElek Imre2014-11-18 23:01:03részletek
1831topacel.huTop Acél Kft.2014-11-20 19:01:19részletek
1832topapartman.huBluecast Kft. (Registrar)2014-11-17 19:01:16részletek
1833topesztergalas.huBakos Bálint2014-11-24 14:01:07részletek
1834tophir.huKirály Tamás2014-11-24 14:01:24részletek
1835tothgabriella.huTóth Gabriella2014-11-17 19:01:19részletek
1836toyota-budapest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1837toyota-frey.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
1838toyota-pest.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1839toyota-szalon.huEmil Frey Magyarország Kft2014-11-18 14:01:12részletek
1840toyotacenter.huEmil Frey Magyarország Kft2014-11-18 14:01:15részletek
1841toyotazuglo.huEmil Frey Magyarország Kft2014-11-18 14:01:13részletek
1842tömbsajt.huFoodnet Kft.2014-11-21 19:01:17részletek
1843train4gain.huTrainforgain Kft2014-11-19 19:01:05részletek
1844trainingcamphungary.huHírös Sport Szabadidő Létesítményeket Működtető és Szolgáltató Kft2014-11-21 19:01:06részletek
1845traktortrade.huTraktor Trade Kft2014-11-18 23:01:15részletek
1846transzfer-eger.huDONUCS SPEED Bt.2014-11-18 14:01:16részletek
1847travelchef.huAgrocorp Consulting Kft2014-11-21 14:01:12részletek
1848trealautosiskola.huT-REÁL Autós-Motorosiskola Kf2014-11-24 14:01:25részletek
1849trenditv.huEuroCable Magyarorszag Kft.2014-11-17 14:01:20részletek
1850trinomkft.huTRINOM Kft.2014-11-18 14:01:23részletek
1851trofeaebed.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:07részletek
1852trófeaebéd.huFEHÉRI és BOGNÁR Kft.2014-11-18 14:01:06részletek
1853tudatos-szepseg.huAnonymouse Domains s.r.o.2014-11-24 14:01:02részletek
1854turbointercooler.huDomokos Péter2014-11-20 19:01:12részletek
1855turoczibarna.huTuróczi Barnabás2014-11-21 23:01:03részletek
1856tuzepbolt.huGerbner Dániel Ádám2014-11-19 23:01:04részletek
1857tuzepshop.huGerbner Dániel Ádám2014-11-20 14:01:10részletek
1858tuzifagyar.huIwood Kft.2014-11-18 19:01:01részletek
1859tuzraktar.huClub-Mate Hungary Kft.2014-11-21 14:01:27részletek
1860tuzvedelemszaklap.huFórum Média Kiadó Kft.2014-11-18 14:01:20részletek
1861tvcool.huEuroCable Magyarorszag Kft.2014-11-17 14:01:12részletek
1862tvjegy.huEuroCable Magyarorszag Kft.2014-11-20 19:01:17részletek
1863typhoontrade.huSzeles Szabolcs2014-11-19 23:01:06részletek
1864ubmmedica.huKrix Zoltán2014-11-19 19:01:08részletek
1865ugytar.huBroadBit Hungary Kft.2014-11-20 19:01:07részletek
1866ugyved-katalogus.huKányási Péter2014-11-18 14:01:20részletek
1867ugyvedadatbazis.huLawmatch Tanácsadó és Szolgáltató Korlátolt Felelősségű Társaság2014-11-21 14:01:23részletek
1868ugyvedegyesulet.huMagyar Ügyvédek Egyesülete2014-11-18 14:01:21részletek
1869ugyveditudastar.huMenedzser Praxis Kft.2014-11-18 14:01:02részletek
1870ugyvedmiskolc.hudr Harsányi Ádám Marcell2014-11-19 14:01:11részletek
1871ujrendszervaltas.huNoname Domain Kft.2014-11-18 23:01:22részletek
1872ujszilvasiskola.huTápiószőlős-Újszilvás Ref. Ált. Isk. és Óvoda2014-11-19 19:01:12részletek
1873uknow.huJaczkó Róbert Gyula EV2014-11-21 19:01:20részletek
1874ulogarnitura-albadivani.huHorizonet Kft. 2014-11-17 19:01:04részletek
1875ultetokartya.huIkeszep Bt.2014-11-18 14:01:12részletek
1876unico.huKrix Zoltán2014-11-20 14:01:11részletek
1877unitedline.huKovács Miklós2014-11-18 23:01:10részletek
1878universalmedia.huKnapp Dávid2014-11-18 19:01:03részletek
1879upmicro.huKrix Zoltán2014-11-19 19:01:10részletek
1880urbanpm.huAdacta Systems Kft.2014-11-20 19:01:03részletek
1881uresbeszed.huErdős Nóra2014-11-17 14:01:14részletek
1882usfsbudapesthomes.huKudelász Balázs2014-11-18 14:01:15részletek
1883uttern.huGrassland Kft2014-11-17 19:01:19részletek
1884uvegfalrendszer.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:02részletek
1885uvegfalrendszerek.huDOORLAND Szolgáltató és Kereskedelmi Kft2014-11-19 19:01:22részletek
1886uzletekpapa.huStone-Press Bt.2014-11-18 14:01:10részletek
1887uzletiajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
1888v8.forum.huV8 IT & MEDIA Kft.2014-11-21 14:01:13részletek
1889vabrikpaintball.huVabrik és Fia Kft2014-11-17 19:01:10részletek
1890vacizsuzsa.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
1891vacizsuzsanna.huDr. Váci Zsuzsanna2014-11-18 23:01:16részletek
1892vacskamati.huSári Márton2014-11-20 19:01:04részletek
1893vakkancskozmetika.huJuhász András2014-11-21 14:01:10részletek
1894valentinra.huRegiszter Plakát Nyomda Kft.2014-11-17 14:01:09részletek
1895valentinre.huRegiszter Plakát Nyomda Kft.2014-11-16 19:01:05részletek
1896valiszepseg.huSzoboszlay András2014-11-17 14:01:14részletek
1897valmontkontroll.huSzabó József EV.2014-11-18 14:01:25részletek
1898vanilia123.huLászló Éva2014-11-17 14:01:23részletek
1899vanillaworks.huJózsef Adrienn2014-11-18 14:01:03részletek
1900varazshangulat.huPilling Tünde2014-11-19 14:01:12részletek
1901varoslodiovoda.huHegyi Attila2014-11-17 14:01:11részletek
1902vasivizszereles.huSákovics Bence 2014-11-21 19:01:08részletek
1903vasscsalad.huVass Bence2014-11-17 14:01:23részletek
1904vastalanito.huFürjesi Bálint2014-11-20 14:01:12részletek
1905vasutihid.huKrix Zoltán2014-11-19 19:01:07részletek
1906vcoin.huEuroCable Magyarorszag Kft.2014-11-18 23:01:20részletek
1907vcredit.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1908veddaszarnyaidala.huACG Reklámügynökség Kft.2014-11-19 19:01:22részletek
1909vedoszarny.huACG Reklámügynökség Kft.2014-11-19 19:01:02részletek
1910veganelet.huBiztos Holnap szociális szövetkezet2014-11-17 19:01:02részletek
1911vegasburger.huHolló Zsuzsanna2014-11-19 14:01:19részletek
1912velenceistukko.huSipőcz Kft.2014-11-20 19:01:12részletek
1913velenceitavieskuvo.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
1914velenceitavieskuvok.huGeicz-Molnár Szilvia2014-11-18 23:01:05részletek
1915vendeglatoingatlanok.huHiker 2000 Bt.2014-11-18 14:01:08részletek
1916vengerka.huVesogama Kft.2014-11-21 19:01:13részletek
1917verbaline.huVerbaline Kft.2014-11-20 19:01:15részletek
1918verhigitas.huTamás Ákos2014-11-24 14:01:07részletek
1919verticalinverse.huSzénási Levente2014-11-19 23:01:05részletek
1920vessey.huVéssey Dávid2014-11-24 14:01:14részletek
1921vgeotechnika.huVincze-Gál Geotechnika Bt.2014-11-18 23:01:04részletek
1922viaferrata-dolomitok.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:10részletek
1923viaferrata-garda-to.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:20részletek
1924viaferrata-rax.huMagyar Kaland - Sport Egyesület2014-11-17 19:01:22részletek
1925vibratorextra.huIllés Krisztina2014-11-21 14:01:21részletek
1926vicavirag.huÁbrahám Éva E.V.2014-11-20 19:01:15részletek
1927videoakku.huSysinfo Kft.2014-11-20 19:01:07részletek
1928viessmann-3d.huVIESSMANN Modellgyártó Kft2014-11-20 19:01:11részletek
1929vilagitaskorszerusites.huE.ON Energiakereskedelmi Kft.2014-11-17 14:01:07részletek
1930villamgrill.huJuhász Benjámin2014-11-19 23:01:06részletek
1931villanymargareta.huPászti János2014-11-17 19:01:22részletek
1932vinko.huVinkó Zoltán Tamás2014-11-18 19:01:04részletek
1933violetpiano.huViolet Piano Kft.2014-11-19 23:01:02részletek
1934virtualbank.huEuroCable Magyarorszag Kft.2014-11-18 19:01:05részletek
1935virusirtasszolnok.huADACSA Kft.2014-11-18 14:01:12részletek
1936viz-urb.huVarga Imre Zoltán2014-11-19 14:01:20részletek
1937vizafogolakasszovetkezet.huVizafogó Lakásfenntartó Szövetkezet2014-11-24 14:01:14részletek
1938vizfutes.huTóth Ferenc2014-11-19 19:01:19részletek
1939vizmernok.huKristóf Csaba2014-11-19 14:01:10részletek
1940vizslafun.huHorváth Dóra2014-11-24 14:01:16részletek
1941vízmérnök.huKristóf Csaba2014-11-19 14:01:08részletek
1942voicegroup.huCyclick Kft.2014-11-19 23:01:08részletek
1943volkeroliver.huVölker Tamás2014-11-21 14:01:05részletek
1944völker.huVölker Tamás2014-11-18 19:01:02részletek
1945vp-cloud.huGASORG Kft.2014-11-20 14:01:14részletek
1946vpospay.huEuroCable Magyarorszag Kft.2014-11-18 23:01:18részletek
1947vrbolt.huSánta Sándor2014-11-18 23:01:21részletek
1948vrjatekok.huSánta Sándor2014-11-18 23:01:22részletek
1949vrshop.huSánta Sándor2014-11-18 23:01:22részletek
1950vrszemuveg.huSánta Sándor2014-11-18 23:01:24részletek
1951vrszemuvegek.huSánta Sándor2014-11-18 23:01:24részletek
1952vteshungariangrandprix.huNémeth Zoltán2014-11-18 23:01:11részletek
1953vtransfer.huEuroCable Magyarorszag Kft.2014-11-18 23:01:19részletek
1954vv9.huKókai László2014-11-18 14:01:07részletek
1955wallies.huKrix Zoltán2014-11-20 14:01:09részletek
1956watersafe-system.huCsiba Gergely2014-11-19 14:01:19részletek
1957watersafe.huCsiba Gergely2014-11-19 14:01:19részletek
1958wdconsulting.huWD Consulting Kft2014-11-20 14:01:02részletek
1959webajanlata.huUngár Ferenc2014-11-18 19:01:05részletek
1960webdesignart.huVoleszák-Szabó Anita2014-11-19 19:01:20részletek
1961webdesignsolution.huVisnyocki Norbert2014-11-19 19:01:20részletek
1962webedinadesign.huRobin és Társa Bt.2014-11-19 19:01:19részletek
1963webfunz.huNoname Domain Kft.2014-11-20 14:01:08részletek
1964webjogforras.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:30részletek
1965webjogtanacsado.huDr. Kerekes Gabor Ügyvédi Iroda2014-11-21 14:01:18részletek
1966webkepzes.huBalla Ádám2014-11-17 14:01:03részletek
1967weboldalszolnok.huADACSA Kft.2014-11-18 14:01:14részletek
1968webpay.huEuroCable Magyarorszag Kft.2014-11-18 19:01:04részletek
1969webrain.huKrix Zoltán2014-11-19 19:01:08részletek
1970weddingonline.huKovács Ádám e.v. 2014-11-17 14:01:14részletek
1971weldminker.huWeldminker Kft.2014-11-21 14:01:09részletek
1972wellnesspatextil.huDagdelen Emrah2014-11-18 19:01:03részletek
1973welovelashes.huMáté Ágnes2014-11-19 14:01:04részletek
1974whakaako.huWhakaako Oktató és Tanácsadó Kft.2014-11-24 14:01:27részletek
1975whiteingatlan.huSmicskó Ágnes e. v.2014-11-18 23:01:04részletek
1976windowsvilag.huMolnar Sándor2014-11-21 14:01:14részletek
1977wineboutiqe.huBusiness Innovant Kft.2014-11-18 14:01:17részletek
1978wineboutique.huBusiness Innovant Kft. 2014-11-21 19:01:05részletek
1979winedesign.huNotrix-Magyarország Kft2014-11-19 14:01:12részletek
1980wireless-center.huCre-Active Bt2014-11-24 14:01:22részletek
1981wizardkartya.huSuba Gergely2014-11-16 19:01:05részletek
1982wmaps.huKrix Zoltán2014-11-19 19:01:15részletek
1983wokzilla.huPADOS PIPI Kereskedelmi Betéti Társaság2014-11-21 19:01:19részletek
1984wonder-cool.huBrill Life Média Kft.2014-11-16 19:01:04részletek
1985woodman.huErdélyi-Woodman Kft.2014-11-18 23:01:03részletek
1986wooo.huVIDGET.HU Kft.2014-11-18 19:01:06részletek
1987wordpressecurity.huSzokolai Róbert E.V.2014-11-24 14:01:02részletek
1988workofficeconsulting.huWork Office Consulting Kft2014-11-24 14:01:17részletek
1989worldgaming.huEuromarknet Kft. (Registrar)2014-11-24 14:01:07részletek
1990wwair.huEuroDNS S.A.2014-11-19 14:01:21részletek
1991xconnections.huHPS Experience Kft.2014-11-19 23:01:09részletek
1992xes.huMolnár Enikő2014-11-18 14:01:02részletek
1993xmix.huEucalyptus Kft.2014-11-19 23:01:06részletek
1994xplaykonzol.huMolnár Judit Egyéni vállalkozó2014-11-20 14:01:02részletek
1995xrosecrystal.huDáné Alexandra2014-11-17 14:01:19részletek
1996xtree.huProfilm DTP Kft.2014-11-18 14:01:13részletek
1997xxl-tuning.huKrix Zoltán2014-11-19 19:01:08részletek
1998yaleszefek.huDimat Fűtéstechnika Kft2014-11-18 23:01:18részletek
1999yanghong.huYang Hong Kft.2014-11-21 14:01:25részletek
2000yangli.huYangli Kft.2014-11-21 14:01:25részletek
2001yemail.huWinkler Balázs2014-11-21 23:01:02részletek
2002youngbeauty.huYoung Beauty Bt.2014-11-20 19:01:18részletek
2003yourbenefits.huMustafa Györgyi Gina2014-11-18 19:01:03részletek
2004yoursclub.huCséfai Nóra2014-11-20 14:01:15részletek
2005yuhu.huNoname Domain Kft.2014-11-18 23:01:22részletek
2006yuhuu.huHajnády Bence2014-11-20 19:01:10részletek
2007yupri.huPreisvergleich.de Berlin AG2014-11-18 14:01:18részletek
2008zavas.huZAVAS, poslovne resitve, d.o.o.2014-11-21 19:01:19részletek
2009zegmechatronika.huPannon Fejlesztési Alapítvány2014-11-17 19:01:03részletek
2010zeisslataskozpont.huKAISER OPTIKA Szemüvegszalon Kereskedelmi Korlátolt Felelősségű Társaság2014-11-21 23:01:01részletek
2011zeissvisioncenter.huKAISER OPTIKA Szemüvegszalon Kereskedelmi Korlátolt Felelősségű Társaság2014-11-21 23:01:02részletek
2012zemplenkincsei.huZemplén Kincsei Szociális Szövetkezet2014-11-17 14:01:24részletek
2013zenmate.huZenGuard GmbH2014-11-18 19:01:02részletek
2014zoldautomento.huMolnár Dávid2014-11-21 14:01:12részletek
2015zoldero.huRuffnet Zrt.2014-11-17 19:01:18részletek
2016zoldhazak.huSilicium Network Kft. (Registrar)2014-11-19 19:01:06részletek
2017zoldkalocsa.huKeiok Kft.2014-11-19 14:01:15részletek
2018zoldso.huB és K Trade Kft.2014-11-20 19:01:20részletek
2019zombiland.huFTV MEDIA sro2014-11-24 14:01:21részletek
2020zoutube.huWebsupport s.r.o.2014-11-19 19:01:22részletek
2021zselicsaba.huZseli Csaba2014-11-20 14:01:12részletek
2022zselicvendeghaz.huField & Forest Kft.2014-11-19 19:01:19részletek
2023zsemlemorzsa.huMéry Zoltán2014-11-21 14:01:23részletek
2024zsireltavolitas.huUnidomain Kft.2014-11-24 14:01:06részletek
2025zsoltrozsnyai.huRozsnyai Zsolt2014-11-19 19:01:14részletek
2026zsuroteam.huIT DEPO Kft.2014-11-19 23:01:05részletek
2027zsuti.huKétsopronyi ZSUTI Szociális Szövetkezet2014-11-24 14:01:12részletek
2028zyq108.huPongrácz Tibor2014-11-21 19:01:02részletek
Főlap | Regisztrátorok listája | Delegálási szabályok | Meghirdetés | Keresés | Technikai ellenőrzés
Tanácsadó testület | Alternatív vitarendezés | Eseti Választottbíróság | Archívum | Egyebek | Statisztika